Polypeptide MELO3C011470P1

Accession: MELO3C011470P1

Name: MELO3C011470P1

Description: Similar to Uncharacterized protein At4g33100 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SMZ9|Y4331_ARATH)

Sequence:

>MELO3C011470P1 Similar to Uncharacterized protein At4g33100 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SMZ9|Y4331_ARATH)
MGIKRESKSSASATSPCADLRAAYHNCFNRWYSEKFVKGNWDEEPCVSEWQKYRACLYEHLDDKKLKRFLEEETLVHSSM
KSDGS*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: cytochrome-c oxidase activity.

cellular_component: mitochondrial intermembrane space, nucleus.

biological_process: pronephros development, mitochondrial respiratory chain complex assembly, apoptosis.

These properties come from phylome analysis


molecular_function: caspase inhibitor activity, protein binding, cytochrome-c oxidase activity.

cellular_component: perinuclear region of cytoplasm, mitochondrion, mitochondrial intermembrane space, nucleus.

biological_process: DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest, anti-apoptosis, mitochondrial respiratory chain complex assembly, apoptosis.

Locations

Located in CM3.5_scaffold00014 from 5843491 to 5843939.

This polypeptide in other databases

In PhylomeDB is Phy003A52S_CUCME .

Related features