Polypeptide MELO3C011494P1

Accession: MELO3C011494P1

Name: MELO3C011494P1

Description: Similar to Copper transporter 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q93VM8|COPT5_ARATH)

Sequence:

>MELO3C011494P1 Similar to Copper transporter 5 (Arabidopsis thaliana) (uniprot_sprot:sp|Q93VM8|COPT5_ARATH)
MMHMTFYWSKEVTLLINSWRTNSWLSYSLSLLACFIVSVFYQYLENYRIRLKLLQCPKPSPSEIEAPLLRSKVAGKFQAL
RFAGALFFGVNSAIGYLLMLAIMSFNGGVFVAIVFGLAIGYLVFRSDDEDVIVSVENPCACA*

Download fasta sequence.

Properties

These properties come from blast2go analysis


cellular_component: plasma membrane, vacuole.

These properties come from reactome analysis


REACTOME_REACTION: Cellular copper transport is mediated by human copper transporter 1 hCTR1 (REACT_20667), Cellular copper transport is mediated by human copper transporter 1 hCTR1 (REACT_107013).

REACTOME_PATHWAY: SLC-mediated transmembrane transport (REACT_19118), Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds (REACT_43374), Metal ion SLC transporters (REACT_20547), Transmembrane transport of small molecules (REACT_102897), Transmembrane transport of small molecules (REACT_15518), Transport of glucose and other sugars, bile salts and organic acids, metal ions and amine compounds (REACT_19305), Metal ion SLC transporters (REACT_88166), SLC-mediated transmembrane transport (REACT_101577).

biological_process: transmembrane transport.

These properties come from phylome analysis


molecular_function: high affinity copper ion transmembrane transporter activity, copper ion transmembrane transporter activity.

cellular_component: integral to membrane, vacuolar membrane, late endosome, plasma membrane, vacuole.

biological_process: response to abscisic acid stimulus.

These properties come from kegg analysis


KEGG_ORTHOLOGS: solute carrier family 31 (copper transporter), member 1 (K14686).

molecular_function: copper ion transmembrane transporter activity.

Locations

Located in CM3.5_scaffold00014 from 6061007 to 6061435.

This polypeptide in other databases

In PhylomeDB is Phy003AAM9_CUCME .

Related features