Polypeptide MELO3C011641P1

Accession: MELO3C011641P1

Name: MELO3C011641P1

Description: Similar to Gamma-secretase subunit APH1-like (Arabidopsis thaliana) (uniprot_sprot:sp|Q8L9G7|APH1_ARATH)

Sequence:

>MELO3C011641P1 Similar to Gamma-secretase subunit APH1-like (Arabidopsis thaliana) (uniprot_sprot:sp|Q8L9G7|APH1_ARATH)
MTVSAGIGYTLIALGPSLSLFISVIAHKPFLILTLLSSTLLWLISLILLSALWRGFLPLNSTVLWPYVILILTSVIFQEV
LRVLFWKVYRRLEDMLDAFADRVSKPRLYLTDKMQIALAGGLGHGISHAVFFCLSLLTPSFGPATYFVDRCSQLPFFLVS
AIIALAFVTIHTFSMVIAFNGYSEGKKVDQYFVPVIHLAAGMVTLVNFASGGCVIGIPLLYIMAILTLIHCGKMVWRRLM
ENRSRQGNR*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: NEXT4 is cleaved to produce NICD4 (REACT_965), NEXT3 is cleaved to produce NICD3 (REACT_1803), NEXT2 is cleaved to produce NICD2 (REACT_103855), gamma-secretase cleaves p75NTR, releasing NRIF and TRAF6 (REACT_13710), gamma-secretase cleaves the p75NTR transmembrane domain (REACT_13609), NEXT1 is cleaved to produce NICD1 (REACT_1784), NEXT2 is cleaved to produce NICD2 (REACT_1306), NEXT1 is cleaved to produce NICD1 (REACT_34376).

biological_process: nerve growth factor receptor signaling pathway, Notch receptor processing, membrane protein intracellular domain proteolysis, apoptosis, induction of apoptosis by extracellular signals, Notch signaling pathway.

REACTOME_COMPLEX: gamma-secretase complex [plasma membrane] (REACT_5292).

REACTOME_PATHWAY: Signaling by Notch (REACT_78520), Cell death signalling via NRAGE, NRIF and NADE (REACT_13720), p75 NTR receptor-mediated signalling (REACT_13776), NRIF signals cell death from the nucleus (REACT_13643), Signalling by NGF (REACT_11061), A third proteolytic cleavage releases NICD (REACT_31981), Signaling by Notch (REACT_299), Regulated proteolysis of p75NTR (REACT_13443), A third proteolytic cleavage releases NICD (REACT_691).

These properties come from phylome analysis


molecular_function: endopeptidase activity, protein binding.

cellular_component: integral to plasma membrane, integral to membrane.

biological_process: Notch signaling pathway, positive regulation of catalytic activity, protein processing.

These properties come from blast2go analysis


molecular_function: protein binding.

cellular_component: integral to membrane.

biological_process: positive regulation of catalytic activity, protein processing.

Locations

Located in CM3.5_scaffold00015 from 4678742 to 4692592.

This polypeptide in other databases

In PhylomeDB is Phy003LLCT_CUCME .

Related features