Polypeptide MELO3C012972P1
Accession: MELO3C012972P1
Name: MELO3C012972P1
Description: Similar to Homeobox-leucine zipper protein GLABRA 2 (Arabidopsis thaliana) (uniprot_sprot:sp|P46607|HGL2_ARATH)
Sequence:
>MELO3C012972P1 Similar to Homeobox-leucine zipper protein GLABRA 2 (Arabidopsis thaliana) (uniprot_sprot:sp|P46607|HGL2_ARATH) MWILQDSSTNSSESMVVYSGVDVTSMQSVMSGCDSGSVTILPSGFSILPDGADSRPPLLITRRKDDKTSDTHGGALLTAA VQILTDTSPAAKPTLESVEYVKSIICCTLKNIRTSMCCEED*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: sequence-specific DNA binding, sequence-specific DNA binding transcription factor activity.
cellular_component: nucleus.
biological_process: regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003AB0Y_CUCME .

