Polypeptide MELO3C013015P1

Accession: MELO3C013015P1

Name: MELO3C013015P1

Description: Similar to Putative mediator of RNA polymerase II transcription subunit 6 (Dictyostelium discoideum) (uniprot_sprot:sp|Q54PN3|MED6_DICDI)

Sequence:

>MELO3C013015P1 Similar to Putative mediator of RNA polymerase II transcription subunit 6 (Dictyostelium discoideum) (uniprot_sprot:sp|Q54PN3|MED6_DICDI)
MPAAPQPPGTDMTGICFRDQLWLNTYPLDRNLVFDYFALSPFYDWTCNNEQLRMRSIHPLDLSQLSKMTGIEYMLNEVME
PHLFVFRKQKRDGPEKVTPMLTYYILDGSIYQAPQLCNVFAARVSRALYYISKAFTTASSKLEKIGYVDSENESEEVKPA
KETINFKEVKRVDHILASLQRKLPPAPPPPPFPEGYAPAPTADTEKGPENQQGESQQPSADPIIDQGPAKRMKF*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: RNA polymerase II transcription mediator activity, protein binding.

cellular_component: mediator complex.

biological_process: regulation of transcription from RNA polymerase II promoter.

These properties come from reactome analysis


REACTOME_REACTION: PPARG:RXRA Heterodimer Binds to Fatty Acid-like Ligands (REACT_27257), Formation of TRAP coactivator complex (REACT_12410), Formation of ARC coactivator complex (REACT_12480), Formation of DRIP coactivator complex (REACT_12379).

biological_process: gene expression.

REACTOME_COMPLEX: ARC coactivator complex [nucleoplasm] (REACT_12961), Mediator Complex (consensus) [nucleoplasm] (REACT_27330), PPARG:RXRA:fatty acid:Mediator:Coactivator Complex [nucleoplasm] (REACT_27768), TRAP coactivator complex [nucleoplasm] (REACT_13344), DRIP coactivator complex [nucleoplasm] (REACT_13011).

REACTOME_PATHWAY: Diabetes pathways (REACT_15380), Generic Transcription Pathway (REACT_12627), Transcriptional Regulation of White Adipocyte Differentiation (REACT_27161), Gene Expression (REACT_71).

These properties come from phylome analysis


molecular_function: transcription coactivator activity, RNA polymerase II transcription factor activity, RNA polymerase II transcription cofactor activity, RNA polymerase II transcription mediator activity, protein binding.

cellular_component: cytoplasm, mediator complex.

biological_process: oogenesis, positive regulation of transcription from RNA polymerase II promoter, hermaphrodite genitalia development, negative regulation of vulval development, growth, embryo development ending in birth or egg hatching, gonad development, spermatogenesis, germ cell development, transcription from RNA polymerase II promoter, transcription, DNA-dependent, nematode larval development, regulation of transcription from RNA polymerase II promoter.

These properties come from kegg analysis


KEGG_ORTHOLOGS: mediator of RNA polymerase II transcription subunit 6 (K15128).

molecular_function: RNA polymerase II transcription cofactor activity.

Locations

Located in CM3.5_scaffold00018 from 4455847 to 4458853.

This polypeptide in other databases

In PhylomeDB is Phy003LJPD_CUCME .

Related features