Polypeptide MELO3C013349P1
Accession: MELO3C013349P1
Name: MELO3C013349P1
Description: Similar to SKP1-like protein 1B (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FHW7|SKP1B_ARATH)
Sequence:
>MELO3C013349P1 Similar to SKP1-like protein 1B (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FHW7|SKP1B_ARATH) MSSSKKIVLRSSDGETFDVDEIVAVESQTIKHMIEDDCVDTVIPLPNVTSAILSKVVEYCKMHVETDDKDSKVIDDTLKT WDAEFVKVDQNTLFDLILAANYLNIKSLLDLTCQTVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein binding.
biological_process: ubiquitin-dependent protein catabolic process.
These properties come from reactome analysis
REACTOME_REACTION: Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_101640), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_6827), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_10082), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_106550), Ubiquitination of CD4 by Vpu:CD4:beta-TrCP:SKP1 complex (REACT_9063), The Vpu:CD4:beta-TrCP complex recruits SKP1 (REACT_9071), Release of E3 from polyubiquitinated substrate (REACT_75928), Binding of phospho-p27/p21:Cdk2:Cyclin E/A to the SCF(Skp2):Cks1 complex (REACT_9060), Interaction of E3 with substrate and E2-Ub complex (REACT_75856), Transfer of Ub from E2 to substrate and release of E2 (REACT_75901), The SCF betaTrCP complex binds p-NFkB p105 (REACT_22353), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_9977), Ubiquitination of Emi1 by SCF-beta-TrCP (REACT_89304), Association of Cks1 with SCF(Skp2) complex (REACT_9017), Multi-ubiquitination of phospho-beta-catenin by SCF-beta-TrCP1 (REACT_31397), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_88235), Phosphorylated Emi1 binds the beta-TrCP in the SCF complex (REACT_6863), Association of beta-catenin with the SCF-beta-TrCP1 ubiquitin ligase complex (REACT_34050), Association of Cks1 with SCF(Skp2) complex (REACT_109793), Beta-TrCP ubiquitinates then dissociates from p-NFKB p105 (REACT_22407), Ubiquitination of phospho-p27/p21 (REACT_9026).
biological_process: viral reproduction, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, mitotic cell cycle, antigen processing and presentation of peptide antigen via MHC class I, protein polyubiquitination, positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, G1/S transition of mitotic cell cycle, S phase of mitotic cell cycle.
REACTOME_COMPLEX: Ag-substrate:E3:E2:Ub [cytosol] (REACT_76727), SCF betaTrCP complex:p-NFKB p105 [cytosol] (REACT_22646), E3:Ub:substrate [cytosol] (REACT_76185), CD4:Vpu:beta-TrCP_1:Skp1 complex [endoplasmic reticulum membrane] (REACT_9120), SCF-beta-TrCP1 complex [cytosol] (REACT_6992), E3:K48-polyubiquitinated substrate [cytosol] (REACT_75972), RBX1-CUL7-SKP1-FBXW8 [cytosol] (REACT_76145), Vpu:beta-TrCP1:Skp1 complex [endoplasmic reticulum membrane] (REACT_9101), SCF(Skp2) complex [nucleoplasm] (REACT_9339), SCF-beta-TrCP:phospho-Emi1 complexes [cytosol] (REACT_7039), SCF-associated multiubiquitinated Emi1complexes [cytosol] (REACT_7461), SCF-beta-TrCP1 complex associated with phosphorylated beta-catenin [cytosol] (REACT_10593), Cyclin E/A:Cdk2:multiubiquitinated phospho-p27/p21:SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9266), Cyclin E/A:Cdk2:phospho-p27/p21:SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9193), multiubiquitinated CD4:Vpu:beta-TrCP_1:Skp1 complex [endoplasmic reticulum membrane] (REACT_9344), RBX1-CUL1-SKP1-CDC4 [cytosol] (REACT_76392), SCF beta-TrCP complex [cytosol] (REACT_22981), ubiquitinated phospho-beta-catenin:SCF:beta-TrCP1 complex [cytosol] (REACT_10202), SCF(Skp2):Cks1 complex [nucleoplasm] (REACT_9182).
REACTOME_PATHWAY: G1/S Transition (REACT_45711), Mitotic G1-G1/S phases (REACT_28641), Cell Cycle, Mitotic (REACT_84794), Regulation of APC/C activators between G1/S and early anaphase (REACT_28152), Cell Cycle, Mitotic (REACT_96281), Cytokine Signaling in Immune system (REACT_75790), APC/C-mediated degradation of cell cycle proteins (REACT_80330), S Phase (REACT_899), SCF(Skp2)-mediated degradation of p27/p21 (REACT_53431), Class I MHC mediated antigen processing & presentation (REACT_75820), Mitotic G1-G1/S phases (REACT_21267), Cell Cycle, Mitotic (REACT_152), G1/S Transition (REACT_1783), Regulation of mitotic cell cycle (REACT_78703), Cyclin E associated events during G1/S transition (REACT_1574), Regulation of APC/C activators between G1/S and early anaphase (REACT_6837), Cyclin A:Cdk2-associated events at S phase entry (REACT_9029), Regulation of APC/C activators between G1/S and early anaphase (REACT_103190), SCF(Skp2)-mediated degradation of p27/p21 (REACT_9003), Interleukin-1 signaling (REACT_22442), Adaptive Immunity Signaling (REACT_75774), SCF-beta-TrCP mediated degradation of Emi1 (REACT_106884), SCF-beta-TrCP mediated degradation of Emi1 (REACT_93035), Signaling by Wnt (REACT_89971), Degradation of beta-catenin by the destruction complex (REACT_89447), Immune System (REACT_6900), S Phase (REACT_105829), Cyclin E associated events during G1/S transition (REACT_93369), Degradation of beta-catenin by the destruction complex (REACT_81971), HIV Infection (REACT_6185), Host Interactions of HIV factors (REACT_6288), SCF-beta-TrCP mediated degradation of Emi1 (REACT_6821), APC/C-mediated degradation of cell cycle proteins (REACT_77053), Cyclin A:Cdk2-associated events at S phase entry (REACT_105319), Regulation of mitotic cell cycle (REACT_21279), APC/C-mediated degradation of cell cycle proteins (REACT_6828), Antigen processing: Ubiquitination & Proteasome degradation (REACT_75842), Signaling by Wnt (REACT_82742), Signaling by Wnt (REACT_11045), Signaling by Interleukins (REACT_22232), Vpu mediated degradation of CD4 (REACT_9031), Degradation of beta-catenin by the destruction complex (REACT_11063), Regulation of mitotic cell cycle (REACT_33905).
These properties come from phylome analysis
molecular_function: protein binding.
biological_process: ubiquitin-dependent protein catabolic process.
These properties come from kegg analysis
COG: SCF ubiquitin ligase, SKP1 component (COG5201).
This polypeptide in other databases
In PhylomeDB is Phy003LM5V_CUCME .