Polypeptide MELO3C013443P1

Accession: MELO3C013443P1

Name: MELO3C013443P1

Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_38.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U5K8)

Sequence:

>MELO3C013443P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_38.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7U5K8)
MGKNRRLKDGADKGAAAGDHCPSKVFVKNLPYSFTNSQLEETFSDVGPVRRCFMVTQKGSTEHRGFGFVQFAVAEDANRA
IQLKNGLSFEGRKITVKHAMHRAPLEQRRSKENQVAASTLEANVEGDTSEMEEQPTNKDRGTSKRDEQPIDKERDTSKRA
EQTISNSEGKERHLSARKLASLSSYLEDKKGHSGKQRIARTVVIGGLLDGDMAEDVHRQVKDAGGVCSIVYPLPRKEVEQ
HGILRDGCKMDVSAVLFDSVKSARAAVTILHQKEMKGGVVWARQLGGEVNHT*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: binding.

These properties come from reactome analysis


REACTOME_REACTION: Transport of the Mature IntronlessTranscript Derived Histone mRNA:SLBP:TAP:Aly/Ref complex through the NPC (REACT_100049), Formation of the Spliceosomal B Complex (REACT_90182), Formation of the active Spliceosomal C complex (REACT_89446), Formation of an intermediate Spliceosomal C complex (REACT_108009), Formation of Exon Junction Complex (REACT_92827), Transport of the export-competent complex through the NPC (REACT_100279), Release of the SLBP independent Histone mRNA from the NPC (REACT_92048), Release from the NPC and Disassembly of the mRNP (REACT_91579), Transport of the Mature Intronless Transcript Derived Histone mRNA:TAP:Aly/Ref Complex through the NPC (REACT_109623), Transport of the Mature intronless transcript derived mRNA:TAP:Aly/Ref Complex through the NPC (REACT_77395), Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Release of the Mature intronless derived mRNA, TAP, and Aly/Ref from the NPC (REACT_28678), Release of the Mature intronless transcript derived Histone mRNA:SLBP:eIF4E Complex (REACT_109313).

REACTOME_PATHWAY: mRNA Splicing - Major Pathway (REACT_91611), Transport of Mature Transcript to Cytoplasm (REACT_30429), Transport of Mature mRNAs Derived from Intronless Transcripts (REACT_96477), Formation and Maturation of mRNA Transcript (REACT_77979), Gene Expression (REACT_105649), Transport of Mature mRNA derived from an Intron-Containing Transcript (REACT_98338), mRNA Processing (REACT_29019), mRNA Splicing (REACT_94469), Transport of the SLBP Dependant Mature mRNA (REACT_88700), Transport of the SLBP independent Mature mRNA (REACT_106457), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), Transport of Mature mRNA Derived from an Intronless Transcript (REACT_100967).

biological_process: mRNA export from nucleus, RNA splicing, gene expression, nuclear mRNA splicing, via spliceosome.

These properties come from phylome analysis


molecular_function: protein binding, RNA binding, nucleic acid binding, nucleotide binding.

cellular_component: catalytic step 2 spliceosome, precatalytic spliceosome, nuclear membrane, nucleoplasm, nucleus.

biological_process: mRNA processing, nuclear mRNA splicing, via spliceosome.

These properties come from kegg analysis


COG: RNA-binding proteins (RRM domain) (COG0724).

Locations

Located in CM3.5_scaffold00019 from 5677056 to 5680513.

This polypeptide in other databases

In PhylomeDB is Phy003MJI8_CUCME .

Related features