Polypeptide MELO3C013741P1

Accession: MELO3C013741P1

Name: MELO3C013741P1

Description: Similar to DNA-directed RNA polymerase II subunit RPB1 (Arabidopsis thaliana) (uniprot_sprot:sp|P18616|RPB1_ARATH)

Sequence:

>MELO3C013741P1 Similar to DNA-directed RNA polymerase II subunit RPB1 (Arabidopsis thaliana) (uniprot_sprot:sp|P18616|RPB1_ARATH)
MDLRFPYSPAEVAKVRMVQFGILSPDEIRQMSVVQIEHGETTERGKPKVAGLSDPRLGTIDRKMKCETCTANMAECPGHF
GHLELAKPMFHIGFMKTVLTIMRSVCFNCSKILVDEEDPKFKQALRIKNPKNRLRKILDACKNKTKCEGGDEIDVQGQDS
DQPVKKSRGGCGAQQPKITIEGMKMTAEYKAQRKKNDDQEQLPEPVERKQTLTAERVLGILKRITDDDCKLLGLNPKYAR
PDWMILQVLPIPPPPVRPSVMMDTSSRSEDDLTHQLAMIIRHNENLRRQERNGSPAHIISEFAQLLQFHIATYFDNELPG
LPRATQRSGRPIKSICSRLKAKEGRIRGNLMGKRVDFSARTVITPDPTINIDELGVPWSIALNLTYPETVTPYNIERLKE
LVEYGPHPPPGKTGAKYIIRDDGQRLDLRYLKKSSDHHLELGYKARFSVERHLNDGDFVLFNRQPSLHKMSIMGHRIKIM
PYSTFRLNLSVTSPYNADFDGDEMNMHVPQSFETRAEVLELMMVPKCIVSPQSNRPVMGIVQDTLLGCRKITKRDTFITK
DVFMNILMWWEDFDGKIPAPAILKPQPLWTGKQVFNLIIPKQINLTRTSAWHSESETGHVTPGDTFVRIEKGELLSGTLC
KKALGTSTGSLIHVIWEEVGPDAARKFLGHTQWLVNYWLLQNAFSIGIGDTIADAATMEKINETISAAKNEVKNLIKKAQ
ERSLEPEPGRTMMDSFENKVNQVLNKARDDAGSSAQKSLSESNNLKAMVTAGSKGSFINISQMTACVGQQNVEGKRIPFG
FIDRTLPHFTKDDYGPESRGFVENSYLRGLTPQEFFFHAMGGREGLIDTAVKTSETGYIQRRLVKAMEDIMVKYDGTVRN
SLGDVIQFLYGEDGMDAVWIESQKLDSLKMKKKEFERIFRYEFEDENWKPNYMLPEHVEDLKTIREFRNVFEAEVQKLEA
DRYQLGTEIATTGENSWPMPVNLKRLIQNAQKTFKIDFRRASDMHPMEIVEAIDKLQERLKVVPGEDPLSVEAQKNATLF
FNILLRSTFASKRVLDEYRLTREAFEWVIGEIESRFLQSLVAPGEMIGCVAAQSIGEPATQMTLNTFHYAGVSAKNVTLG
VPRLREIINVAKRIKTPSLSVYLKPEANKTKERAKTVQCALEYTTLRSVTQATEVWYDPDPMSTIIEEDIDFVKSYYEMP
DEEIAPEKISPWLLRIELNREMMVDKKLSMANIAEKINLEFDDDLTCIFNDDNAEKLILRIRIMNDEAPKGELTDESAED
DVFLKKIESNMLTEMALRGIPDINKVFIKCGKVNKFDENEGFKPEMEWMLDTEGVNLLAVMCHEDVDARRTTSNHLIEVI
EVLGIEAVRRSLLDELRVVISFDGSYVNYRHLAILCDTMTYRGHLMAITRHGINRNDTGPMMRCSFEETVDILLDAAVYA
ETDHLRGVTENIMLGQLAPIGTGGCALYLNDEMLKNAIELQLPSYIDGLDFGMTPSRSPISGTPYHEGMMSPNYLLSPNL
RLSPISDAQFSPYVGGMAFSPTSSPGYSPSSPGYSPSSPGYSPTSPGYSPTSPGYSPTSPGYSPTSPTYSPSSPGYSPTS
PAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPAYSPTSPAYSPTSPSYSPTSPSY
SPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTXXXXXXXVIILNQLNTAHRRHTHPVVHGCLLQVHIAQPRPIT
AQRRHHILLLLQHILHPARPTVLAVHIIQDPAQTTALVLHSTVQVQGTHLLLLGILHHLLVSTLHKQVTRMIGVERMIGT
IDDESSKANILEGRG*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: protein binding, DNA-directed RNA polymerase activity, DNA binding.

cellular_component: chloroplast, vacuole, DNA-directed RNA polymerase II, core complex.

biological_process: transcription from RNA polymerase II promoter.

These properties come from reactome analysis

REACTOME_REACTION: Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_103685), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_93493), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_81825), Dissociation of transcript with 5-GMP from GT (REACT_106203), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_85239), Capping complex formation (REACT_77633), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_108201), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_104426), Fall Back to Closed Pre-initiation Complex (REACT_86577), Formation of active Pol II complex with lesioned DNA template (REACT_28257), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_99814), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_99299), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_34583), Capping complex formation (REACT_91663), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_29681), Formation of AT-AC C complex (REACT_78819), Extrusion of 5-end of 30 nt long transcript through the pore in Pol II complex (REACT_108808), Activation of GT (REACT_103525), DSIF complex binds to RNA Pol II (hypophosphorylated) (REACT_88434), Addition of nucleotides between position +11 and +30 (REACT_28970), Dissociation of transcript with 5-GMP from GT (REACT_87469), Methylation of GMP-cap by RNA Methyltransferase (REACT_97945), Addition of nucleotides 10 and 11 on the growing transcript: Third Transition (REACT_88577), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Fall Back to Closed Pre-initiation Complex (REACT_98220), ATAC spliceosome mediated 3 splice site cleavage, exon ligation (REACT_105023), Formation of the CE:GMP intermediate complex (REACT_101635), ATAC spliceosome mediated Lariat formation,5 splice site cleavage (REACT_81096), Hydrolysis of the 5-end of the nascent transcript by the capping enzyme (REACT_94470), Formation of the closed pre-initiation complex (REACT_91116), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Activation of GT (REACT_106797), Internal Methylation of mRNA (REACT_101890), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_85925), Formation of the CE:GMP intermediate complex (REACT_110689), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_92765), RNA Pol II is blocked by the lesion leading to reduced transcription (REACT_90318), Resumption of transcription after TC-NER (REACT_94622), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_102473), Formation of the closed pre-initiation complex (REACT_105039), Formation of active Pol II complex with lesioned DNA template (REACT_89270), Displacement of stalled Pol II from the lesion site (REACT_108076), Addition of nucleotides between position +11 and +30 (REACT_28303), Formation of AT-AC B Complex (REACT_90655), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_96127), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Displacement of stalled Pol II from the lesion site (REACT_103124), Phosphorylation (Ser5) of RNA pol II CTD (REACT_88766), Abortive termination of early transcription elongation by DSIF:NELF (REACT_86233), Transfer of GMP from the capping enzyme GT site to 5-end of mRNA (REACT_103482), Resumption of transcription after TC-NER (REACT_101665), Formation of AT-AC B Complex (REACT_93825), Internal Methylation of mRNA (REACT_28726), RNA Polymerase II CTD (phosphorylated) binds to CE (REACT_84917), NTP Binds Active Site of RNA Polymerase II (REACT_80120), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Formation of AT-AC C complex (REACT_83124), Methylation of GMP-cap by RNA Methyltransferase (REACT_96650), SPT5 subunit of Pol II binds the RNA triphosphatase (RTP) (REACT_81891), RNA Polymerase II Promoter Opening: First Transition (REACT_93391), Hypophosphorylation of RNA Pol II CTD by FCP1P protein (REACT_86293), Phosphorylation (Ser5) of RNA pol II CTD (REACT_31984).

biological_process: mRNA capping, nuclear mRNA splicing, via spliceosome, nucleotide-excision repair, DNA repair, transcription-coupled nucleotide-excision repair, RNA splicing, transcription elongation from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter, gene expression, transcription from RNA polymerase II promoter.

REACTOME_PATHWAY: Formation of transcription-coupled NER (TC-NER) repair complex (REACT_86892), RNA Polymerase II Promoter Escape (REACT_106149), Nucleotide Excision Repair (REACT_96106), Processing of Capped Intron-Containing Pre-mRNA (REACT_31128), mRNA Processing (REACT_94551), DNA Repair (REACT_107446), Nucleotide Excision Repair (REACT_77033), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_28862), Processing of Capped Intron-Containing Pre-mRNA (REACT_109442), Transcription-coupled NER (TC-NER) (REACT_96116), Formation of the Early Elongation Complex (REACT_84349), mRNA Splicing - Minor Pathway (REACT_91088), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Formation and Maturation of mRNA Transcript (REACT_85219), RNA Polymerase II Promoter Escape (REACT_32829), mRNA Splicing (REACT_81581), RNA Polymerase II Pre-transcription Events (REACT_99660), Gene Expression (REACT_85241), RNA Pol II CTD phosphorylation and interaction with CE (REACT_96584), Transcription-coupled NER (TC-NER) (REACT_93719), Formation and Maturation of mRNA Transcript (REACT_92291), Formation of transcription-coupled NER (TC-NER) repair complex (REACT_88014), RNA Polymerase II Transcription Initiation (REACT_105389), mRNA Splicing - Minor Pathway (REACT_88186), RNA Polymerase II Transcription Elongation (REACT_94090), mRNA Processing (REACT_109337), Formation of the Early Elongation Complex (REACT_29380), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_78187), RNA Polymerase II Pre-transcription Events (REACT_91410), RNA Polymerase II Transcription (REACT_97471), Transcription (REACT_99758), DNA Repair (REACT_82907), mRNA Capping (REACT_93735), RNA Polymerase II Transcription Elongation (REACT_107633), Transcription (REACT_93622), mRNA Splicing (REACT_98879), Gene Expression (REACT_91657), RNA Polymerase II Transcription (REACT_89454), mRNA Capping (REACT_81603), Dual incision reaction in TC-NER (REACT_91002), RNA Pol II CTD phosphorylation and interaction with CE (REACT_28314), RNA Polymerase II Transcription Initiation (REACT_88340), Dual incision reaction in TC-NER (REACT_109190).

These properties come from phylome analysis

molecular_function: metal ion binding, protein binding, DNA-directed RNA polymerase activity, DNA binding.

cellular_component: chloroplast, vacuole, DNA-directed RNA polymerase II, core complex.

biological_process: transcription, DNA-dependent, transcription from RNA polymerase II promoter.

These properties come from kegg analysis

KEGG_REACTION: UTP:RNA (R00443), CTP:RNA (R00442), GTP:RNA (R00441), ATP:polynucleotide (R00435).

KEGG_ORTHOLOGS: DNA-directed RNA polymerase II subunit RPB1 [EC:2.7.7.6] (K03006).

molecular_function: DNA-directed RNA polymerase activity.

COG: DNA-directed RNA polymerase, beta' subunit/160 kD subunit (COG0086).

Locations

Located in CM3.5_scaffold00021 from 387826 to 395934.

This polypeptide in other databases

In PhylomeDB is Phy003MDZT_CUCME .

Related features