Polypeptide MELO3C013822P1
Accession: MELO3C013822P1
Name: MELO3C013822P1
Description: Similar to Defender against cell death 1 (Betula pendula) (uniprot_sprot:sp|Q9M3T9|DAD1_BETPN)
Sequence:
>MELO3C013822P1 Similar to Defender against cell death 1 (Betula pendula) (uniprot_sprot:sp|Q9M3T9|DAD1_BETPN) MARSTSKDAQALFQSLCSAYAATPTTLKIIDLYVIYAVFTALIQVAYMAIVGSFPFNSFLSGVLSCIGTAVLAVCLRIQV NKENKEFKDLAPERAFADFVLCNLVLHLVIINFLG*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: dolichyl-diphosphooligosaccharide-protein glycotransferase activity.
cellular_component: integral to membrane.
biological_process: apoptosis.
These properties come from reactome analysis
REACTOME_REACTION: Transfer of N-glycan to the protein (REACT_22208), Transfer of N-glycan to the protein (REACT_84238), Transfer of N-glycan to the protein (REACT_107399), Transfer of N-glycan to the protein (REACT_85218), Transfer of N-glycan to the protein (REACT_32942), Transfer of N-glycan to the protein (REACT_32860).
biological_process: cellular protein metabolic process, post-translational protein modification, protein N-linked glycosylation via asparagine.
REACTOME_COMPLEX: OST complex [endoplasmic reticulum membrane] (REACT_23228).
REACTOME_PATHWAY: Asparagine N-linked glycosylation (REACT_97528), Post-translational protein modification (REACT_22161), Metabolism of proteins (REACT_86658), Metabolism of proteins (REACT_102155), Asparagine N-linked glycosylation (REACT_107490), Metabolism of proteins (REACT_99179), Post-translational protein modification (REACT_78573), Post-translational protein modification (REACT_101114), Metabolism of proteins (REACT_17015), Asparagine N-linked glycosylation (REACT_94271), Asparagine N-linked glycosylation (REACT_31880), Metabolism of proteins (REACT_91052), Asparagine N-linked glycosylation (REACT_107317), Metabolism of proteins (REACT_85873), Asparagine N-linked glycosylation (REACT_22426), Post-translational protein modification (REACT_104966), Post-translational protein modification (REACT_83761), Post-translational protein modification (REACT_91222).
These properties come from phylome analysis
molecular_function: identical protein binding, protein binding, dolichyl-diphosphooligosaccharide-protein glycotransferase activity.
cellular_component: oligosaccharyltransferase complex, integral to membrane.
biological_process: post-translational protein modification, negative regulation of apoptosis, locomotion, positive regulation of growth rate, growth, protein N-linked glycosylation via asparagine, embryo development ending in birth or egg hatching, anti-apoptosis, receptor-mediated endocytosis, protein N-linked glycosylation, nematode larval development, apoptosis.
These properties come from kegg analysis
KEGG_ORTHOLOGS: oligosaccharyltransferase complex subunit epsilon (K12668).
cellular_component: oligosaccharyltransferase complex.
This polypeptide in other databases
In PhylomeDB is Phy003A1CO_CUCME .

