Polypeptide MELO3C014124P1

Accession: MELO3C014124P1

Name: MELO3C014124P1

Description: Similar to Photosystem I reaction center subunit V, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q9S7N7|PSAG_ARATH)

Sequence:

>MELO3C014124P1 Similar to Photosystem I reaction center subunit V, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q9S7N7|PSAG_ARATH)
MAAASSSAVFVAPTFSATATRQQPSPTTISFQGLRALPSVKSSRSIVATKTRRSMTVKAELNPSLVISLSTGLSLFLGRF
VFFNFQRENVSKQVPEQNGLTHFEAGDVRAKEYVSLLKSNDPVGFNIVDVLAWGSIGHIVAYYILATSSNGYDPKFF*

Download fasta sequence.

Properties

These properties come from kegg analysis

KEGG_ORTHOLOGS: photosystem I subunit V (K08905).

These properties come from phylome analysis

molecular_function: chlorophyll binding.

cellular_component: chloroplast photosystem I, chloroplast envelope, integral to membrane, photosystem I.

biological_process: protein stabilization, photosystem I stabilization, photosynthetic NADP+ reduction, photosynthetic electron transport in photosystem I, photosynthesis.

These properties come from blast2go analysis

cellular_component: integral to membrane, chloroplast thylakoid membrane, photosystem I.

biological_process: photosynthesis.

Locations

Located in CM3.5_scaffold00021 from 4403254 to 4403727.

This polypeptide in other databases

In PhylomeDB is Phy003AE37_CUCME .

Related features