Polypeptide MELO3C014183P1

Accession: MELO3C014183P1

Name: MELO3C014183P1

Description: Similar to Small ubiquitin-related modifier 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FLP6|SUMO2_ARATH)

Sequence:

>MELO3C014183P1 Similar to Small ubiquitin-related modifier 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FLP6|SUMO2_ARATH)
MSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSIAFLFDGRRLRAEQTPEELEM
EDGDEIDAMLHQTGGGGAII*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: PIAS1 binds p-STAT1 dimer (REACT_25331).

biological_process: regulation of interferon-gamma-mediated signaling pathway, interferon-gamma-mediated signaling pathway, cytokine-mediated signaling pathway.

REACTOME_COMPLEX: p-STAT1 dimer:PIAS:SUMO1 [nucleoplasm] (REACT_25840).

REACTOME_PATHWAY: Interferon gamma signaling (REACT_25078), Interferon Signaling (REACT_25229), Cytokine Signaling in Immune system (REACT_75790), Immune System (REACT_6900), Regulation of IFNG signaling (REACT_24980).

These properties come from phylome analysis


molecular_function: protein tag.

cellular_component: cytoplasm, nucleus.

biological_process: protein sumoylation, response to heat.

These properties come from kegg analysis


KEGG_ORTHOLOGS: small ubiquitin-related modifier (K12160).

Locations

Located in CM3.5_scaffold00021 from 5373081 to 5374594.

This polypeptide in other databases

In PhylomeDB is Phy003A2YD_CUCME .

Related features