Polypeptide MELO3C014183P1
Accession: MELO3C014183P1
Name: MELO3C014183P1
Description: Similar to Small ubiquitin-related modifier 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FLP6|SUMO2_ARATH)
Sequence:
>MELO3C014183P1 Similar to Small ubiquitin-related modifier 2 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FLP6|SUMO2_ARATH) MSGVTNQEEDKKPTDQSAHINLKVKGQDGNEVFFRIKRSTQLKKLMNAYCDRQSVDLNSIAFLFDGRRLRAEQTPEELEM EDGDEIDAMLHQTGGGGAII*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: PIAS1 binds p-STAT1 dimer (REACT_25331).
biological_process: regulation of interferon-gamma-mediated signaling pathway, interferon-gamma-mediated signaling pathway, cytokine-mediated signaling pathway.
REACTOME_COMPLEX: p-STAT1 dimer:PIAS:SUMO1 [nucleoplasm] (REACT_25840).
REACTOME_PATHWAY: Interferon gamma signaling (REACT_25078), Interferon Signaling (REACT_25229), Cytokine Signaling in Immune system (REACT_75790), Immune System (REACT_6900), Regulation of IFNG signaling (REACT_24980).
These properties come from phylome analysis
molecular_function: protein tag.
cellular_component: cytoplasm, nucleus.
biological_process: protein sumoylation, response to heat.
These properties come from kegg analysis
KEGG_ORTHOLOGS: small ubiquitin-related modifier (K12160).
This polypeptide in other databases
In PhylomeDB is Phy003A2YD_CUCME .

