Polypeptide MELO3C014472P1
Accession: MELO3C014472P1
Name: MELO3C014472P1
Description: Similar to Mitogen-activated protein kinase 20 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SJG9|MPK20_ARATH)
Sequence:
>MELO3C014472P1 Similar to Mitogen-activated protein kinase 20 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SJG9|MPK20_ARATH) MQTDHRKKNSAELDFFSEYGDANRFKVREVIGKGSYGVVCSAVDTLTNEKVAIKKIHDIFEHVSDAARILREIKLLRLLR HPDIVEIKHIMLPPSRRGFKDIFVVFELMESDLHQVIKANDDLTKEHYQFFLYQLLRALKYIHTANVYHRDLKPKNILAN ANCKLKICDFGLARVAFSDTPTTIFWTDYVATRWYRAPELCGSFFSKYTPAIDIWSIGCIFAEVLTGKPLFPGKNIVHQL DLMTDLLGTPSLDTISRVRNEKARRYLTSMRKKQPISFSQKFPNADPLALQLLQRLLAFDPKDRPTAEEALADPYFKGLA KVEREPSCQPISKVEFEFERRKVTKDDIRELIFLEILEYHPQLLKDYLNGTERSNFLYPSALDQFKKQFAHLEDNGGKSG PVYPLERKHASLPRSSVQSNTIPPKVTSNIVSFKDRYAPSGPFGSQLYKDSAAQRIAAAQAKPGRISGPVMPYDSGSTIK DAYDPRMLIRSALPSHAIHPTYYYQQSCGQNEERSATGAEQDTSMQCKQSPQCGMAAKLAGDTAAASGAFSNSFFMARVG MPKMGNNDRAAHLQVSAQYDAGAVAAATTTTHRNTGVVEYSMTRMC*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: ERK5 translocates to the nucleus (REACT_95956), ERK5 translocates to the nucleus (REACT_110814), ERK5 is activated (REACT_100829), ERK5 activates the transcription factor MEF2 (REACT_86006), ERK5 activates the transcription factor MEF2 (REACT_97335), ERK5 is activated (REACT_104581).
biological_process: MyD88-independent toll-like receptor signaling pathway, MyD88-dependent toll-like receptor signaling pathway, nerve growth factor receptor signaling pathway, toll-like receptor 4 signaling pathway, stress-activated MAPK cascade, innate immune response, toll-like receptor signaling pathway, Toll signaling pathway, toll-like receptor 1 signaling pathway, toll-like receptor 2 signaling pathway, toll-like receptor 3 signaling pathway.
REACTOME_PATHWAY: NGF signalling via TRKA from the plasma membrane (REACT_107118), ERK/MAPK targets (REACT_31414), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_79305), Signalling to ERK5 (REACT_31272), Toll Like Receptor 3 (TLR3) Cascade (REACT_34013), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_33857), Signalling by NGF (REACT_90112), MyD88 cascade initiated on plasma membrane (REACT_104035), MyD88-independent cascade initiated on plasma membrane (REACT_85813), MyD88 dependent cascade initiated on endosome (REACT_29524), Toll Like Receptor TLR1:TLR2 Cascade (REACT_89891), Innate Immunity Signaling (REACT_95642), Signalling by NGF (REACT_82686), Toll Receptor Cascades (REACT_85362), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_106858), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_28593), Toll Like Receptor 2 Cascade (REACT_29705), TRAF6 Mediated Induction of proinflammatory cytokines (REACT_30390), MyD88:Mal cascade initiated on plasma membrane (REACT_99530), Toll Receptor Cascades (REACT_98692), MyD88 dependent cascade initiated on endosome (REACT_88704), MAP kinase activation in TLR cascade (REACT_34622), NFkB and MAP kinases activation mediated by TLR4 signaling repertoire (REACT_85088), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_95399), MyD88:Mal cascade initiated on plasma membrane (REACT_80624), Toll Like Receptor TLR6:TLR2 Cascade (REACT_79076), TRAF6 mediated induction of NFkB and MAP kinases upon TLR7/8 or 9 activation (REACT_85188), Toll Like Receptor 2 Cascade (REACT_92918), NGF signalling via TRKA from the plasma membrane (REACT_102976), Innate Immunity Signaling (REACT_108180), Toll Like Receptor 4 (TLR4) Cascade (REACT_91584), Toll Like Receptor 3 (TLR3) Cascade (REACT_87070), Nuclear Events (kinase and transcription factor activation) (REACT_104146), Toll Like Receptor 7/8 (TLR7/8) Cascade (REACT_96421), Immune System (REACT_81385), Toll Like Receptor 5 (TLR5) Cascade (REACT_77312), MAPK targets/ Nuclear events mediated by MAP kinases (REACT_104956), Activated TLR4 signalling (REACT_91273), Nuclear Events (kinase and transcription factor activation) (REACT_82900), Toll Like Receptor 5 (TLR5) Cascade (REACT_82163), Activated TLR4 signalling (REACT_33197), Toll Like Receptor TLR6:TLR2 Cascade (REACT_103395), MyD88 cascade initiated on plasma membrane (REACT_96209), Toll Like Receptor TLR1:TLR2 Cascade (REACT_91544), Toll Like Receptor 9 (TLR9) Cascade (REACT_103126), Toll Like Receptor 4 (TLR4) Cascade (REACT_80044), Immune System (REACT_84034), Signalling to ERK5 (REACT_107061), Toll Like Receptor 10 (TLR10) Cascade (REACT_102819), MyD88-independent cascade initiated on plasma membrane (REACT_28410), MAP kinase activation in TLR cascade (REACT_98311), Toll Like Receptor 9 (TLR9) Cascade (REACT_93905), Toll Like Receptor 10 (TLR10) Cascade (REACT_110819), ERK/MAPK targets (REACT_97877).
These properties come from phylome analysis
molecular_function: ATP binding, protein binding, MAP kinase activity.
biological_process: protein phosphorylation.
These properties come from blast2go analysis
molecular_function: ATP binding, protein binding, MAP kinase activity.
cellular_component: mitochondrion.
biological_process: protein phosphorylation.
This polypeptide in other databases
In PhylomeDB is Phy003A7IK_CUCME .

