Polypeptide MELO3C014514P1
Accession: MELO3C014514P1
Name: MELO3C014514P1
Description: Similar to Transcription factor E2FB (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FV71|E2FB_ARATH)
Sequence:
>MELO3C014514P1 Similar to Transcription factor E2FB (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FV71|E2FB_ARATH) MSGSRPPNSSGHLPDQIMHSLKRQLPFSSVKPPFASPGDYHRFAPDSRLADQESDAIVVKSPQLKRKSEVADYEAESTDR AIGPRFAEVVNSPHQTPVSVKGGKGSKSRLTKCSRSGPQTPMSNVGSPSTNNLTPAGPCRYDSSLGLLTKKFINLIKQAE DGILDLNKAADTLEVQKRRIYDITNVLEGIGLIEKKLKNRIQWKGLDVSRSGDVDDNYADLQAEVENLTMEERGLDEQIR EMQERLRDLSEDENNQRQWLFVTEEDIKGLPCFQNETLIAIKAPHGTTLEVPDPDEAVDYPQRRYRIVLRSTMGPIDVYL VSQFEAKFEEINAAEMPPSLPSSSGLNEAPTTTVVTEDTRGKEIETREQDVHRMCSDLNASQDFVGGIMKIVPSVVDSDA DYWLLSDADVSITDMWRTERILTI*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: Replication initiation regulation by Rb1/E2F1 (REACT_1277), Association of Cyclin A:phospho-Cdk2(Thr 160) with E2F1/E2F3 (REACT_104661), Replication initiation regulation by E2F1/Rbf1 (REACT_1967), Phosphorylation of E2F1/E2F3 by Cyclin A:phosph-Cdk2(Thr 160) (REACT_9023), Phosphorylation of E2F1/E2F3 by Cyclin A:phosph-Cdk2(Thr 160) (REACT_104569), Association of Cyclin A:phospho-Cdk2(Thr 160) with E2F1/E2F3 (REACT_9021), Cyclin D:Cdk4/6 mediated phosphorylation of Rb and dissociation of phospho-Rb from the E2F1/2/3:DP-1 complexes (REACT_1882).
biological_process: G1 phase of mitotic cell cycle, G2 phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, mitotic cell cycle.
REACTOME_COMPLEX: Rb-E2F1/2/3:DP-1 complex [nucleoplasm] (REACT_4483), DP-1:E2F1/2/3 [nucleoplasm] (REACT_76628), Cyclin A:phospho-Cdk2(Thr160):phospho-E2F1/E2F2 complex [nucleoplasm] (REACT_9267), Aborted replication complex [nucleoplasm] (REACT_2817), Cyclin A:phospho-Cdk2(Thr160):E2F1/E2F3 complex [nucleoplasm] (REACT_9177), DP-1:E2F1 complex [nucleoplasm] (REACT_5400), Aborted replication complex [nucleoplasm] (REACT_4193).
REACTOME_PATHWAY: G2 Phase (REACT_1915), Mitotic G1-G1/S phases (REACT_21267), E2F mediated regulation of DNA replication (REACT_79760), E2F mediated regulation of DNA replication (REACT_471), Cell Cycle, Mitotic (REACT_152), Mitotic G2-G2/M phases (REACT_104892), Mitotic G2-G2/M phases (REACT_21391), Cell Cycle, Mitotic (REACT_96281), G1 Phase (REACT_1590), Cyclin D associated events in G1 (REACT_821), G1/S Transition (REACT_87037), G1/S Transition (REACT_1783), Mitotic G1-G1/S phases (REACT_93079), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_106235), G2 Phase (REACT_104865), Inhibition of replication initiation of damaged DNA by Rb/E2F1 (REACT_329).
These properties come from phylome analysis
molecular_function: DNA binding, protein binding, sequence-specific DNA binding transcription factor activity.
cellular_component: cytoplasm, transcription factor complex.
biological_process: positive regulation of meiotic cell cycle, regulation of cell division, positive regulation of transcription, DNA-dependent, trichome morphogenesis, response to auxin stimulus, positive regulation of cell proliferation, cell cycle, transcription, DNA-dependent, regulation of transcription, DNA-dependent.
These properties come from blast2go analysis
molecular_function: protein binding, sequence-specific DNA binding transcription factor activity.
cellular_component: mitochondrion, transcription factor complex.
biological_process: regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003MF9Z_CUCME .
