Polypeptide MELO3C014694P1

Accession: MELO3C014694P1

Name: MELO3C014694P1

Description: Similar to 60S ribosomal protein L19, mitochondrial (Schizosaccharomyces pombe) (uniprot_sprot:sp|Q9UTK2|RM19_SCHPO)

Sequence:

>MELO3C014694P1 Similar to 60S ribosomal protein L19, mitochondrial (Schizosaccharomyces pombe) (uniprot_sprot:sp|Q9UTK2|RM19_SCHPO)
MATLKEILTRRPVSATIRLTVPAGGARPAPPVGPALGQYRLNLMAFCKDFNARTQKYKPDTPMAVTITAFKDNTFEFTVK
SPSVTWYLKKAAGIESGSSRPGHVVASTLSVKHIYEIAKVKQSDPYCQYMPLESICKSIIGTANSMGIKVLNELE*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: structural constituent of ribosome.

cellular_component: ribosome.

biological_process: translation.

These properties come from phylome analysis


molecular_function: protein binding, structural constituent of ribosome.

cellular_component: mitochondrial large ribosomal subunit, mitochondrion, ribosome.

biological_process: positive regulation of growth rate, growth, mitochondrial translation, gene silencing by RNA, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, regulation of translation, nematode larval development, translation.

Locations

Located in CM3.5_scaffold00022 from 5075548 to 5076015.

This polypeptide in other databases

In PhylomeDB is Phy003A7YW_CUCME .

Related features