Polypeptide MELO3C014824P1

Accession: MELO3C014824P1

Name: MELO3C014824P1

Description: Similar to Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LB02|DHSB2_ARATH)

Sequence:

>MELO3C014824P1 Similar to Succinate dehydrogenase [ubiquinone] iron-sulfur subunit 2, mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q8LB02|DHSB2_ARATH)
MATGILRRVLSRVSASSPSRFVRIRAHASEAEAQQVEQKATASSNLKTFAIYRWNPDSPSKPELQEYKIDLKECGPMVLD
ALIKIKNEIDPSLTFRRSCREGICGSCAMNIDGCNGLACLTKIPSGDSSTITPLPHMFVIKDLVVDMTNFYNQYKSIEPW
LKRKSEPPVPGKEILQSKKDRAKLDGMYECILCACCSTSCPSYWWNPESYLGPAALLHANRWISDSRDEYTKERLEAIND
EFKLYRCHTILNCARACPKGLNPGKQIQHIKSLQLLG*

Download fasta sequence.

Properties

These properties come from kegg analysis

KEGG_REACTION: Succinate:ubiquinone (R02164).

KEGG_ORTHOLOGS: succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1] (K00235).

molecular_function: succinate dehydrogenase (ubiquinone) activity.

KEGG_MODULE: Succinate dehydrogenase (ubiquinone) (M00148).

COG: Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit (COG0479).

These properties come from phylome analysis

molecular_function: iron-sulfur cluster binding, oxidoreductase activity, structural constituent of ribosome, 2 iron, 2 sulfur cluster binding, electron carrier activity, succinate dehydrogenase (ubiquinone) activity.

cellular_component: ribosome.

biological_process: oxidation-reduction process, translation, tricarboxylic acid cycle.

These properties come from blast2go analysis

molecular_function: 2 iron, 2 sulfur cluster binding, electron carrier activity, succinate dehydrogenase (ubiquinone) activity, iron ion binding.

cellular_component: mitochondrion.

biological_process: electron transport chain, tricarboxylic acid cycle.

Locations

Located in CM3.5_scaffold00023 from 2157438 to 2160101.

This polypeptide in other databases

In PhylomeDB is Phy003A0KC_CUCME .

Related features