Polypeptide MELO3C014841P2
Accession: MELO3C014841P2
Name: MELO3C014841P2
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_219.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SPW8)
Sequence:
>MELO3C014841P2 Similar to Whole genome shotgun sequence of line PN40024, scaffold_219.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SPW8) MGNNSERVRLEERKELIICRETMLPLNRLFRTIHTTLNAPQITTFALHAPKYVEVKFADGSVFNLSAEFLRIYSPAADAK VRSIGGEKVIFGRRHVGIMSAEPVGNYGVRILFDDLHRTGIYSWDYFYHLGSNKFTLLRNYVKTLKKHGLSRDPPKRK*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: DNA binding.
cellular_component: mitochondrion.
biological_process: regulation of transcription, DNA-dependent.
These properties come from phylome analysis
molecular_function: DNA binding.
cellular_component: nucleus.
biological_process: oxidation-reduction process, regulation of transcription, DNA-dependent.
This polypeptide in other databases
In PhylomeDB is Phy003LH80_CUCME .

