Polypeptide MELO3C014960P1

Accession: MELO3C014960P1

Name: MELO3C014960P1

Description: Similar to Cytochrome c1-1, heme protein, mitochondrial (Solanum tuberosum) (uniprot_sprot:sp|P25076|CY11_SOLTU)

Sequence:

>MELO3C014960P1 Similar to Cytochrome c1-1, heme protein, mitochondrial (Solanum tuberosum) (uniprot_sprot:sp|P25076|CY11_SOLTU)
MAGGGMIRQLLRKFSSQSSTPPLNSSLISKNQEAGFAGMNSFRRLALLGAGVTGFFSFATLASADEAEHGLECPNYPWPH
QGILSSYDHASIRRGHQVYQQVCASCHSMSLISYRDLVGVAYTEEETKAMAAEIEVVDGPNDEGEMFTRPGKLSDRFPQP
YANEQAARFANGGAYPPDLSLITKARHNGQNYVFALLTGYRDPPAGVSIREGLHYNPYFPGGAIAMPKMLNDGAVEYEDG
TPATEAQMGKDIVSFLSWAAEPEMEERKLMGFKWIFVLSLALLQAAYYRRLKWSVLKSRKLVLDVVN*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: electron transporter, transferring electrons within CoQH2-cytochrome c reductase complex activity, heme binding.

cellular_component: integral to membrane, mitochondrial respiratory chain complex III.

biological_process: transport, mitochondrial electron transport, ubiquinol to cytochrome c.

These properties come from reactome analysis


biological_process: respiratory electron transport chain.

REACTOME_REACTION: Electron transfer from ubiquinol to cytochrome c of complex III (REACT_6300).

REACTOME_COMPLEX: Ubiquinol-cytochrome c reductase [mitochondrial inner membrane] (REACT_6527), Complex III - cytochrome c1-heme complex [mitochondrial inner membrane] (REACT_6582).

REACTOME_PATHWAY: Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. (REACT_6305), Respiratory electron transport (REACT_22393).

These properties come from phylome analysis


molecular_function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity, electron carrier activity, ubiquinol-cytochrome-c reductase activity, protein binding, electron transporter, transferring electrons within CoQH2-cytochrome c reductase complex activity, heme binding.

cellular_component: respiratory chain, cell junction, mitochondrial inner membrane, mitochondrion, integral to membrane, mitochondrial respiratory chain complex III.

biological_process: oxidation-reduction process, hermaphrodite genitalia development, positive regulation of embryonic development, positive regulation of growth rate, growth, respiratory electron transport chain, oviposition, embryo development ending in birth or egg hatching, determination of adult lifespan, nematode larval development, transport, mitochondrial electron transport, ubiquinol to cytochrome c.

These properties come from kegg analysis


KEGG_ORTHOLOGS: ubiquinol-cytochrome c reductase cytochrome c1 subunit (K00413).

molecular_function: ubiquinol-cytochrome-c reductase activity.

COG: Cytochrome c1 (COG2857).

Locations

Located in CM3.5_scaffold00023 from 5377427 to 5380958.

This polypeptide in other databases

In PhylomeDB is Phy003ADMH_CUCME .

Related features