Polypeptide MELO3C015235P2

Accession: MELO3C015235P2

Name: MELO3C015235P2

Description: Similar to Cohesin subunit SA-1 (Homo sapiens) (uniprot_sprot:sp|Q8WVM7|STAG1_HUMAN)

Sequence:

>MELO3C015235P2 Similar to Cohesin subunit SA-1 (Homo sapiens) (uniprot_sprot:sp|Q8WVM7|STAG1_HUMAN)
MEGAAAAPISSGLATRRSKRTRAQTVPAEVQPTNADGGGVDNNDRTSDASGQADRDSSPENFEESRPPRTKRNRLEGTSN
AAHEVSEQSLIDVIKGNGKFIPQVVKRWVERYEKDPKTSMVELLAMLFEACGAKYHIKGDFLEETDVDDVVVALVNLAKR
GEVEDYQSSKRKEFKSFKDNLESFWDHLVHECQHGPLFDQVLFDKCVDYIIALSCTPPRVYRQVASLMGLQLVTSFIGVA
KMLGVQRETTRRQLDAEKKKRAEGPLVESLNKRFSMTHENITVLEEMMRKIFTGLFVHRYRDIDPNIRMSCIQSLGVWIL
SYPSLFLQDLYLKYLGWTLNDKNAGVRKVSVLALQNLYEVDDNVPTLSLFTERFSNRMIELADDIDVSVAVCAIGLVKQL
LRHQLLADDDLGPLYDLLIDDPPEIRHAIGALVYDHLIAQKFTSSQSSRRGDGNSSSEVHLGRMLQILREFSTDPILSIY
VVDDVWEYMNAMKDWKCIISRLLDENPRTELTDEDATNLVRLLSASIKKAVGERIVPATDNRKQYFSKAQKEVFESNRRD
ITVAIMKNYPILLRKFVADKAKVPSLVEIIVHMNLELYSLKRQEQNYKNVLQLMKEAFFKHGDKEALRSCMKAINLCCTD
SQGELQDFSRNKLKELEDELFAKLKHAMRELEDGGDEYSLLVNLKRLYEFQLSRPVPMESIYGDIMMILQKFRSMDDEVV
CFLLLNLYLDLAWSLHSIINSETVSIESLSSLLNKRNALLEHLDLYLNDPTEVCKSGNQLAYRVCTILAELWFLFKKENY
SSTKLERLGYCPDASTVKNFWRLCERQLSISGIGLIVLGLFYGWKGENKLHIHHN*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: DNA binding.

cellular_component: cytoplasmic membrane-bounded vesicle.

These properties come from reactome analysis


REACTOME_REACTION: Phosphorylation of the Scc1:Cohesion Complex (REACT_79686), ATR Phosphorylates Histone H2A.X at Unsynapsed Regions (REACT_75904), Recruitment of ATR Kinase to Unsynapsed Regions (REACT_75923), Phosphorylation of the SA2 Cohesion Complex (REACT_1481), Recruitment of BRCA1 to Unsynapsed Regions (REACT_75884), Phosphorylation of the Scc1:Cohesion Complex (REACT_1362), Phosphorylation of the SA2 Cohesion Complex (REACT_91684), Phosphorylation of the Scc1:Cohesion Complex (REACT_94562), Phosphorylation of the SA2 Cohesion Complex (REACT_30230).

biological_process: mitotic metaphase/anaphase transition, mitotic prometaphase, mitotic cell cycle, M phase of mitotic cell cycle.

REACTOME_COMPLEX: Synaptonemal:BRCA1:ATR Complex [nucleoplasm] (REACT_75938), Meiotic Cohesin Complex [nucleoplasm] (REACT_76256), Unsynapsed Chromatin [nucleoplasm] (REACT_76872), Telomere Attachment Plate [nuclear envelope, nucleoplasm] (REACT_76658), Cohesin Complex with a phosphorylated SA2 Subunit [nucleoplasm] (REACT_5534), Synaptonemal Complex [nucleoplasm] (REACT_76002), Synaptonemal:BRCA1 Complex [nucleoplasm] (REACT_76427), Cohesin Complex with Phosphorylated SA2 and Scc1 Subunits [nucleoplasm] (REACT_3981), Axial/Lateral Element of Synaptonemal Complex [nucleoplasm] (REACT_76597), Cohesin Complex [nucleoplasm] (REACT_3430), Unsynapsed Chromatin containing gamma-H2A.x [nucleoplasm] (REACT_75943).

REACTOME_PATHWAY: M Phase (REACT_910), Cell Cycle, Mitotic (REACT_84794), DNA Replication (REACT_383), Cell Cycle, Mitotic (REACT_96281), M Phase (REACT_93720), Meiotic Synapsis (REACT_75792), Mitotic Prometaphase (REACT_682), Cell Cycle, Mitotic (REACT_152), Mitotic M-M/G1 phases (REACT_21300), Mitotic M-M/G1 phases (REACT_95347), Mitotic Metaphase/Anaphase Transition (REACT_107946), Mitotic Prometaphase (REACT_34037), DNA Replication (REACT_106731), M Phase (REACT_33490), Mitotic M-M/G1 phases (REACT_93881), Mitotic Metaphase/Anaphase Transition (REACT_96680), Mitotic Prometaphase (REACT_83126), DNA Replication (REACT_96557), Mitotic Metaphase/Anaphase Transition (REACT_1016).

These properties come from phylome analysis


molecular_function: protein binding, binding, DNA binding.

cellular_component: chromosome, nucleus, condensed chromosome, chromatin.

biological_process: meiotic sister chromatid cohesion, centromeric, attachment of spindle microtubules to kinetochore involved in homologous chromosome segregation, cell division, meiotic sister chromatid cohesion, hermaphrodite genitalia development, locomotion, embryo development ending in birth or egg hatching, receptor-mediated endocytosis, nematode larval development, mitotic sister chromatid segregation.

These properties come from kegg analysis


KEGG_ORTHOLOGS: cohesin complex subunit SA-1/2 (K06671).

Locations

Located in CM3.5_scaffold00025 from 141940 to 159685.

This polypeptide in other databases

In PhylomeDB is Phy003MFS7_CUCME .

Related features