Polypeptide MELO3C015305P2
Accession: MELO3C015305P2
Name: MELO3C015305P2
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_77.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SYI1)
Sequence:
>MELO3C015305P2 Similar to Whole genome shotgun sequence of line PN40024, scaffold_77.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SYI1) MAGYSSTASDKKSSDSADDIPIFNAENLQNNLKIIYYSRTFLSIIGGVIAGILGFTGLTGFIFYFLVMAITSVALAAKAG FSFHSYFESCNQILLDGFLGGLMSFVLFWTFAYDIVHIF*
Download fasta sequence.
Properties
These properties come from phylome analysis
cellular_component: integral to membrane.
biological_process: growth, embryo development ending in birth or egg hatching, nematode larval development.
This polypeptide in other databases
In PhylomeDB is Phy003LILY_CUCME .