Polypeptide MELO3C015416P1

Accession: MELO3C015416P1

Name: MELO3C015416P1

Description: Similar to Hexokinase-1 (Spinacia oleracea) (uniprot_sprot:sp|Q9SEK3|HXK1_SPIOL)

Sequence:

>MELO3C015416P1 Similar to Hexokinase-1 (Spinacia oleracea) (uniprot_sprot:sp|Q9SEK3|HXK1_SPIOL)
MKKVVVGTALVCAAAVCTAAALVVRHRMKNCGKWSKAMGILKEFEEKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKM
LISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHVMTGTSEELFGFIAEALAKFVEEEGD
GYHPVSGRQRELGFTFSFPVRQTSIASGTLIKWTKGFNIEDTVGQDVVGELTKAMEKIGLDMRVAALVNDTIGTLAGGRY
HNDNVIAAVILGTGTNAAYVERAHAIPKWQGLLPQSGEMVINMEWGNFRSSHLPFTEYDQALDSESLNPGEQIFEKMISG
MYLGEIVRRVLCRMAEEAALFGDVVPPKLKKPFILRTPDMSAMHHDTSPDLKVVGTKLNNILEVSNSPLPLRKIVFELCD
IVATRGARLSAAGIYGIIKKLGRDTPKDGDNQKSVIAVDGGLFEHYTKFRNSLESSLKELLGEQVADNFVIEHSNDGSGI
GAALLAASHSQYLGVEES*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: ATP binding, hexokinase activity.

cellular_component: integral to membrane, chloroplast outer membrane.

biological_process: glycolysis.

These properties come from reactome analysis


REACTOME_REACTION: glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_103208), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_1827), glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_109999), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_28331), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_31874), glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_6714), glucokinase (GCK1) + glucokinase regulatory protein (GKRP) <=> GCK1:GKRP complex (REACT_6771), GCK1:GKRP [cytosol] => GCK1:GKRP [nucleoplasm] (REACT_6938), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_31619), glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_79313), glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_88856), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_33904), cytosolic GCK1:GKRP complex <=> glucokinase (GCK1) + glucokinase regulatory protein (GKRP) (REACT_6920), alpha-D-Glucose + ATP => alpha-D-glucose 6-phosphate + ADP (REACT_96972), glucokinase [nucleoplasm] => glucokinase [cytosol] (REACT_95003), nucleoplasmic GCK1:GKRP complex => glucokinase (GCK1) + glucokinase regulatory protein (GKRP) (REACT_6899).

biological_process: carbohydrate metabolic process, transmembrane transport, glucose transport, hexose transport, regulation of glucose transport.

REACTOME_COMPLEX: GCK1:GKRP complex [nucleoplasm] (REACT_7241), GCK1:GKRP complex [cytosol] (REACT_7407).

REACTOME_PATHWAY: Metabolism of carbohydrates (REACT_83038), Transmembrane transport of small molecules (REACT_102897), SLC-mediated transmembrane transport (REACT_87124), Metabolism of carbohydrates (REACT_107409), Glucose transport (REACT_94026), Hexose transport (REACT_85632), Transmembrane transport of small molecules (REACT_81024), Glucose transport (REACT_77150), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_98854), Hexose transport (REACT_96740), SLC-mediated transmembrane transport (REACT_79921), Transmembrane transport of small molecules (REACT_32055), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_84006), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_79618), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_80959), SLC-mediated transmembrane transport (REACT_101577), SLC-mediated transmembrane transport (REACT_19118), Glucose transport (REACT_34463), Metabolism of carbohydrates (REACT_98394), Glucose transport (REACT_98004), Transmembrane transport of small molecules (REACT_15518), Hexose transport (REACT_110377), Hexose transport (REACT_33190), Transmembrane transport of small molecules (REACT_86409), Metabolism of carbohydrates (REACT_83329), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_80307), SLC-mediated transmembrane transport (REACT_98716), Hexose transport (REACT_104970), Glucose transport (REACT_29233), Transmembrane transport of small molecules (REACT_97365), Hexose transport (REACT_9441), Regulation of Glucokinase by Glucokinase Regulatory Protein (REACT_6804), Metabolism of carbohydrates (REACT_474), Glucose transport (REACT_212), SLC-mediated transmembrane transport (REACT_96636), Metabolism of carbohydrates (REACT_106046).

These properties come from kegg analysis


KEGG_REACTION: ATP:D-fructose (R03920), ATP:D-glucosamine (R01961), ATP:alpha-D-glucose (R01786), ATP:beta-D-glucose (R01600), ATP:D-mannose (R01326), ATP:D-fructose (R00867), ATP:D-glucose (R00299).

molecular_function: hexokinase activity.

Locations

Located in CM3.5_scaffold00025 from 1479950 to 1483419.

This polypeptide in other databases

In PhylomeDB is Phy003A5Z1_CUCME .

Related features