Polypeptide MELO3C015518P4
Accession: MELO3C015518P4
Name: MELO3C015518P4
Description: Similar to Putative uncharacterized protein (Arabidopsis) (uniref90:UniRef90_Q8GUT5)
Sequence:
>MELO3C015518P4 Similar to Putative uncharacterized protein (Arabidopsis) (uniref90:UniRef90_Q8GUT5) MSAAISIYRPEFLGSVQDGCRNHLKFPRTFAFASWNMTMDYKSHQTMKKEEVSIQISTPLLQPKSKPLASNGLQFDRPPP DDEDLVHQRRLEFGQFVAREAVIDEELWTAAWLRAESHWENRQNDRYVDSFKRKFAEQEFNAIKKKCGGQYGQTCTCIVT VRKEQKHIKRTVIKSVVATLDLCLRHLMHGESFPGVEPEFMLLLST*
Download fasta sequence.
Properties
These properties come from blast2go analysis
cellular_component: plastid.

