Polypeptide MELO3C015601P2
Accession: MELO3C015601P2
Name: MELO3C015601P2
Description: Similar to SNF1-related protein kinase regulatory subunit beta-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q84VQ1|KINB1_ARATH)
Sequence:
>MELO3C015601P2 Similar to SNF1-related protein kinase regulatory subunit beta-1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q84VQ1|KINB1_ARATH) MGNANGREQSTPGAPAAGGRADVDAQSPAISSVNSETSNVVSSDSMGNTPPHSPGKFRSPILFAPQIPVAPLQGGNGPTH YNGAWQNEFDGAIDSPPEQGIPTIITWSYGGSNVAVEGSWDNWASRKTLQRTGKDFSLLMVLPSGVYHYKFIVDGQRRYI PDLPFIADEMGNVFNLLNVSDSVPDILQSVAEFEPPQSPETTYSQTFPTEEDFAKEPAAVPSQLHLTVLGMENADEASSS KPQHVVLNHLFIEKGWASQSVVALGLTHRFHSKYVTVVLYKPLNR*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_627), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_11110), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_105858), Activation of cytosolic AMPK by phosphorylation (REACT_31513), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_349), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_88296), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_85508), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_96873), Phosphorylated AMPK binds AMP (REACT_107153), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_28253), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_32411), Phosphorylated AMPK phosphorylates TSC2 (REACT_21348), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_1325), Phosphorylation of ChREBP at Serine 568 by AMPK (REACT_101245), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_79108), Phosphorylated AMPK binds AMP (REACT_31999), Phosphorylated AMPK binds AMP (REACT_28175), LKB1 phosphorylates the alpha subunit of AMPK heterotrimer (REACT_29816), AMPK is dephosphorylated (REACT_109701), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_78314), Phosphorylated AMPK binds AMP (REACT_21293), AMPK is dephosphorylated (REACT_21418), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_34086), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_90770), AMPK phosphorylates Raptor (REACT_21413), Activation of cytosolic AMPK by phosphorylation (REACT_11183), Phosphorylated AMPK binds AMP (REACT_81047), Phosphorylated AMPK binds AMP (REACT_108380), pAMPK inactivates ACC2 inhibiting malonyl-CoA synthesis (REACT_101641), AMPK is dephosphorylated (REACT_79893), Activation of cytosolic AMPK by phosphorylation (REACT_98315), AMP binds to gamma subunit of AMP kinase heterotrimer (REACT_88620), Phosphorylated AMPK phosphorylates TSC2 (REACT_97911).
biological_process: insulin receptor signaling pathway, cellular lipid metabolic process, regulation of fatty acid biosynthetic process, cell cycle arrest, energy reserve metabolic process, carnitine shuttle, regulation of fatty acid oxidation.
REACTOME_COMPLEX: Phosphorylated AMPK heterotrimer [cytosol] (REACT_17720), AMPK heterotrimer:AMP [nucleoplasm] (REACT_4802), AMPK heterotrimer (inactive) [nucleoplasm] (REACT_3733), AMPK heterotrimer [cytosol] (REACT_18135), Phosphorylated AMPK heterotrimer:AMP [cytosol] (REACT_21851), AMPK heterotrimer (active) [cytosol] (REACT_11854), Activated AMPK heterotrimer [nucleoplasm] (REACT_5306).
REACTOME_PATHWAY: Energy dependent regulation of mTOR by LKB1-AMPK (REACT_21387), PI3K Cascade (REACT_29438), Regulation of AMPK activity via LKB1 (REACT_83359), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_30569), PI3K Cascade (REACT_81331), mTOR signalling (REACT_32181), AMPK inhibits chREBP transcriptional activation activity (REACT_86711), Regulation of AMPK activity via LKB1 (REACT_33744), PI3K Cascade (REACT_101713), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_87905), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_94410), Regulation of Rheb GTPase activity by AMPK (REACT_21393), Regulation of Rheb GTPase activity by AMPK (REACT_107474), Insulin receptor signalling cascade (REACT_91258), PKB-mediated events (REACT_87031), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_90301), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_92175), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_87938), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_99720), mTOR signalling (REACT_103104), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_101666), Signaling by Insulin receptor (REACT_78672), PKB-mediated events (REACT_87931), PKB-mediated events (REACT_93663), AMPK inhibits chREBP transcriptional activation activity (REACT_90865), IRS-related events (REACT_29919), mTOR signalling (REACT_109003), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_92909), IRS-related events (REACT_762), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_102111), IRS-mediated signalling (REACT_81492), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_98981), PI3K Cascade (REACT_78238), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_31891), Insulin receptor signalling cascade (REACT_31597), IRS-related events (REACT_104222), Metabolism of lipids and lipoproteins (REACT_81798), IRS-related events (REACT_34425), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_28392), AMPK inhibits chREBP transcriptional activation activity (REACT_102284), Metabolism of lipids and lipoproteins (REACT_22258), AMPK inhibits chREBP transcriptional activation activity (REACT_1988), mTOR signalling (REACT_101313), PKB-mediated events (REACT_456), Integration of energy metabolism (REACT_1505), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_78593), IRS-mediated signalling (REACT_97132), Signaling by Insulin receptor (REACT_97488), Insulin receptor signalling cascade (REACT_1195), Integration of energy metabolism (REACT_89538), PI3K Cascade (REACT_976), Integration of energy metabolism (REACT_87289), Integration of energy metabolism (REACT_93425), IRS-mediated signalling (REACT_82708), Regulation of AMPK activity via LKB1 (REACT_108246), AMPK inhibits chREBP transcriptional activation activity (REACT_104762), Regulation of AMPK activity via LKB1 (REACT_106029), AMPK inhibits chREBP transcriptional activation activity (REACT_109849), Signaling by Insulin receptor (REACT_28335), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_32410), Signaling by Insulin receptor (REACT_101830), Metabolism of lipids and lipoproteins (REACT_104203), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_83004), Integration of energy metabolism (REACT_31409), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_95569), Fatty acid, triacylglycerol, and ketone body metabolism (REACT_22279), PI3K Cascade (REACT_80065), IRS-related events (REACT_87578), Import of palmitoyl-CoA into the mitochondrial matrix (REACT_11082), Regulation of AMPK activity via LKB1 (REACT_86986), Metabolism of lipids and lipoproteins (REACT_79403), IRS-mediated signalling (REACT_332), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_11163), Metabolism of lipids and lipoproteins (REACT_106721), Regulation of AMPK activity via LKB1 (REACT_21285), Signaling by Insulin receptor (REACT_6313), mTOR signalling (REACT_84365), PKB-mediated events (REACT_108221), IRS-mediated signalling (REACT_81127), Insulin receptor signalling cascade (REACT_90766), mTOR signalling (REACT_6838), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_84630), PKB-mediated events (REACT_103699), Energy dependent regulation of mTOR by LKB1-AMPK (REACT_78416), Signaling by Insulin receptor (REACT_498), Insulin receptor signalling cascade (REACT_30654), Metabolism of lipids and lipoproteins (REACT_109614), IRS-related events (REACT_97171), Activated AMPK stimulates fatty-acid oxidation in muscle (REACT_90516), IRS-mediated signalling (REACT_87267), Integration of energy metabolism (REACT_109211), Insulin receptor signalling cascade (REACT_30635).
These properties come from phylome analysis
molecular_function: ATP binding, protein binding.
biological_process: nitrate assimilation, fatty acid biosynthetic process, carbohydrate metabolic process, cellular response to nitrogen levels.
These properties come from blast2go analysis
molecular_function: protein binding.
biological_process: cellular response to nitrogen levels.
This polypeptide in other databases
In PhylomeDB is Phy003AD43_CUCME .

