Polypeptide MELO3C015693P2

Accession: MELO3C015693P2

Name: MELO3C015693P2

Description: Similar to Glutamyl-tRNA synthetase, chloroplastic/mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FEA2|SYE_ARATH)

Sequence:

>MELO3C015693P2 Similar to Glutamyl-tRNA synthetase, chloroplastic/mitochondrial (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FEA2|SYE_ARATH)
MAAVAGTPWVRIKAFPILNPPFLHRSNFYFGERCIPKFRRSFSVSASVDKVDGGGGVRVRFAPSPTGNLHVGGARTALFN
YLFARANGGEFVLRIEDTDLERSTRQSEEAVLRDLSWLGLDWDEGPNVGGEYGPYRQSERNALYKQYAEKLLESGQVYRC
FCSNEELERMKEVAKLNQLPPVYMGKWASATNEEVREELEKGTPYTYRFRVPQEGSLKINDLIRGEVSWNLDTLGDFVIM
RSNGQPVYNFCVTVDDVTMAISHVIRAEEHLPNTLRQALIYKALGFPMPYFAHVSLILAPDRSKLSKRHGATSVGQFREM
GYLPEAMVNYLALLGWGDGTENEFFTLEQLVEKFSISRVNKSGAVFDSTKLRWMNGQHLRALPSEELTKLIGERWKSTGI
LTESEGPFVEESVQLLKDAIDLVTDADKALSNLLSYPLHTTLTSSEAKPLVEDKLSEFSASLIAAYDGGEILNALEEGPS
GWQKWVKSFGKSSKRKGKSLFMPLRLLLTGKIHGPDMGASIVLLHKARSSGVVAPQAGFVPLNDRFEILRQIDWDAVTND
RPLVESPAPAAVPN*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: ATP binding, glutamate-tRNA ligase activity, RNA binding.

cellular_component: mitochondrion.

biological_process: glutamyl-tRNA aminoacylation.

These properties come from reactome analysis

REACTOME_REACTION: glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_93957), glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_87201), glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_78810), glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_15505), glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_82972), glutamate + tRNA(Glu) + ATP => Glu-tRNA(Glu) + AMP + pyrophosphate (REACT_82768).

biological_process: tRNA aminoacylation for protein translation, gene expression.

REACTOME_PATHWAY: tRNA Aminoacylation (REACT_89459), Gene Expression (REACT_85241), Mitochondrial tRNA aminoacylation (REACT_34656), Gene Expression (REACT_98256), Gene Expression (REACT_108313), tRNA Aminoacylation (REACT_33855), Gene Expression (REACT_91657), Mitochondrial tRNA aminoacylation (REACT_15302), Gene Expression (REACT_105649), Gene Expression (REACT_71), Mitochondrial tRNA aminoacylation (REACT_81996), tRNA Aminoacylation (REACT_103575), tRNA Aminoacylation (REACT_99090), Mitochondrial tRNA aminoacylation (REACT_103831), tRNA Aminoacylation (REACT_80723), Mitochondrial tRNA aminoacylation (REACT_100487), tRNA Aminoacylation (REACT_15482), Mitochondrial tRNA aminoacylation (REACT_88111).

These properties come from phylome analysis

molecular_function: protein binding, ATP binding, glutamate-tRNA ligase activity, RNA binding.

cellular_component: chloroplast, mitochondrial matrix, cytoplasm, mitochondrion.

biological_process: mitochondrial glutamyl-tRNA aminoacylation, ovule development, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, chloroplast organization, mitochondrion organization, receptor-mediated endocytosis, nematode larval development, reproduction, glutamyl-tRNA aminoacylation.

These properties come from kegg analysis

KEGG_REACTION: L-glutamate:tRNA(Glu) (R05578).

molecular_function: glutamate-tRNA ligase activity.

COG: Glutamyl- and glutaminyl-tRNA synthetases (COG0008).

Locations

Located in CM3.5_scaffold00026 from 170070 to 181319.

This polypeptide in other databases

In PhylomeDB is Phy003ADCH_CUCME .

Related features