Polypeptide MELO3C015733P1
Accession: MELO3C015733P1
Name: MELO3C015733P1
Description: Similar to Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 (Bos taurus) (uniprot_sprot:sp|Q17R09|PRP16_BOVIN)
Sequence:
>MELO3C015733P1 Similar to Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 (Bos taurus) (uniprot_sprot:sp|Q17R09|PRP16_BOVIN) MRLEMEYNSDRAWYDRDEGNTMFDADSSSFFFGDDAAFQKKEAELAKRLVRRDGTKMTLAQSKKLSQLTADNAQWEDRQL LRSGAVRGTEVQTDFDDEEERKVILLVHDTKPPFLDGRVVFTKQAEPIMPIKDPTSDMAIISRKGSSLVREIHEKQNMNK SRQRFWELAGSKLGDILGVEKTAEQIDADTASVGDEGEVDFKEDAKFAQHMKKGEAVSDFAKSKTIAQQRQYLPIYSVRD ELLQVIRENQVVVVVGETGSGKTTQLTQYLFEDGYTTNGIVGCTQPRRVAAMSVAKRVSEEMECELGDKVGYAIRFEDVT GPSTIIKYMTDGVLLRETLKDSDLEKYRVIVMDEAHERSLSTDVLFGILKKVVAQRRDFKLIVTSATLNAQKFSNFFGSV PIFHIPGRTFPVNTLYSKTPCEDYVEAAVKQAMTIHITSPPGDILIFMTGQDEIEAACFALAERIEQLISSTKKGVPKLL ILPIYSQLPADLQAKIFQKAEDGARKCIVATNIAETSLTVDGIFYVIDTGYGKMKVYNPRMGMDALQVFPVSRAAADQRA GRAGRTGPGTCYRLYTESAYLNEMLPSPVPEIQRTNLGNVVLLLKSLKVENLLDFDFMDPPPQDNILNSMYQLWVLGALN NVGGLTELGWKMVEFPLDPPLAKMLLMGEQLECLDEVLTIVSMLSVPSVFFRPKDRVEESDAARERFFIPESDHLTLYNV YQQWKQHQYRGDWCNDHFLHVKGLRKAREVRSQLLDILKTLKIPLTSCWPDTDLVRKAICSAYFHNAARLKGVGEYVNCR NGMPCHLHPSSALYGMGCTPDYVVYHELILTTKEYMQCATAVEPQWLAELGPMFFSVKESDTSLLEHKKRQKESKTAMEE EMESLRKIQVESEKENKEREKEKRRKQQQQISMPGFRQGSGTYLRPKKLGL*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP-dependent helicase activity, ATP binding, nucleic acid binding.
These properties come from reactome analysis
REACTOME_REACTION: Lariat Formation and 5-Splice Site Cleavage (REACT_28087), Docking of the TAP:EJC Complex with the NPC (REACT_138), Formation of the Spliceosomal B Complex (REACT_90182), Formation of the Spliceosomal A Complex (REACT_788), Formation of an intermediate Spliceosomal C complex (REACT_91565), Formation of an intermediate Spliceosomal C complex (REACT_625), Lariat Formation and 5-Splice Site Cleavage (REACT_82009), Formation of the active Spliceosomal C complex (REACT_1554), Formation of the active Spliceosomal C complex (REACT_89446), Formation of the active Spliceosomal C complex (REACT_63591), Formation of Exon Junction Complex (REACT_85923), Formation of Exon Junction Complex (REACT_92827), Formation of the Spliceosomal B Complex (REACT_48), Formation of Exon Junction Complex (REACT_774), Recruitment of TAP to the EJC (REACT_53), Formation of an intermediate Spliceosomal C complex (REACT_108009), mRNA polyadenylation (REACT_1162), Formation of the Spliceosomal B Complex (REACT_109266), Cleavage of mRNA at the 3-end (REACT_1914), Lariat Formation and 5-Splice Site Cleavage (REACT_1935), Cleavage at the 3-Splice Site and Exon Ligation (REACT_1331).
biological_process: transcription from RNA polymerase II promoter, gene expression, mRNA 3'-end processing, RNA splicing, mRNA export from nucleus, termination of RNA polymerase II transcription, nuclear mRNA splicing, via spliceosome.
REACTOME_COMPLEX: Spliceosomal A Complex [nucleoplasm] (REACT_4512), Exon Junction Complex [nucleoplasm] (REACT_2984), 3 end cleaved, ligated exon containing complex [nucleoplasm] (REACT_3092), Ligated exon containing complex [nucleoplasm] (REACT_5472), Spliceosomal Intermediate C Complex [nucleoplasm] (REACT_5473), 3-polyadenylated, capped mRNA complex [nucleoplasm] (REACT_5827), TAP:3-polyadenylated, capped mRNA complex [nucleoplasm] (REACT_4136), Spliceosomal Active C Complex [nucleoplasm] (REACT_2680), Spliceosomal B Complex [nucleoplasm] (REACT_3078), Spliceosomal active C complex with lariat containing, 5-end cleaved pre-mRNP:CBC complex [nucleoplasm] (REACT_5191).
REACTOME_PATHWAY: Cleavage of Growing Transcript in the Termination Region (REACT_387), Formation and Maturation of mRNA Transcript (REACT_77979), mRNA Processing (REACT_29019), mRNA 3-end processing (REACT_1849), Processing of Capped Intron-Containing Pre-mRNA (REACT_29012), mRNA Processing (REACT_1675), mRNA Splicing (REACT_1735), Transcription (REACT_1788), Transport of Mature Transcript to Cytoplasm (REACT_1281), mRNA Splicing - Major Pathway (REACT_467), Gene Expression (REACT_71), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription (REACT_1366), Post-Elongation Processing of the Transcript (REACT_78), Post-Elongation Processing of Intron-Containing pre-mRNA (REACT_397), Transport of Mature mRNA derived from an Intron-Containing Transcript (REACT_1597), Gene Expression (REACT_108313), Processing of Capped Intron-Containing Pre-mRNA (REACT_125), mRNA Splicing - Major Pathway (REACT_91611), RNA Polymerase II Transcription Termination (REACT_894), mRNA Splicing (REACT_107931), Processing of Capped Intron-Containing Pre-mRNA (REACT_82582), mRNA Splicing - Major Pathway (REACT_93740), Gene Expression (REACT_105649), mRNA Splicing (REACT_94469), Formation and Maturation of mRNA Transcript (REACT_32779), mRNA Processing (REACT_80866).
These properties come from phylome analysis
molecular_function: ATPase activity, uncoupled, RNA-dependent ATPase activity, protein binding, ATP-dependent helicase activity, ATP binding, nucleic acid binding.
cellular_component: catalytic step 2 spliceosome, U2-type catalytic step 2 spliceosome, spliceosomal complex, nucleoplasm, nucleus.
biological_process: regulation of cell proliferation, feminization of hermaphroditic germ-line, regulation of meiosis, mRNA 3'-end processing, body morphogenesis, embryo development ending in birth or egg hatching, RNA splicing, germ cell development, receptor-mediated endocytosis, mRNA export from nucleus, mRNA processing, termination of RNA polymerase II transcription, inter-male aggressive behavior, nematode larval development, nuclear mRNA splicing, via spliceosome, regulation of alternative nuclear mRNA splicing, via spliceosome, generation of catalytic spliceosome for second transesterification step.
These properties come from kegg analysis
KEGG_ORTHOLOGS: pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 [EC:3.6.4.13] (K12815).
COG: HrpA-like helicases (COG1643).
This polypeptide in other databases
In PhylomeDB is Phy003MH66_CUCME .
