Polypeptide MELO3C015883P1
Accession: MELO3C015883P1
Name: MELO3C015883P1
Description: Similar to Histone H2AX (Cicer arietinum) (uniprot_sprot:sp|O65759|H2AX_CICAR)
Sequence:
>MELO3C015883P1 Similar to Histone H2AX (Cicer arietinum) (uniprot_sprot:sp|O65759|H2AX_CICAR) MSSSASSKGGRGKPKATKSVSRSQKAGLQFPVGRIARFLKAGKYAERVGAGAPVYLSAVLEYLAAEVLELAGNAARDNKK NRIVPRHIQLAVRNDEELSKLLGDVTIANGGVLPNIHQTLLPKKAGSGKGDIGSASQEF*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: MDC1/NFBD1associates with gamma H2AX at nuclear foci (REACT_109558), Association of gamma-H2AX with NBS1 (REACT_1800), Association of MRN with sites of DSB (REACT_82130), MDC1/NFBD1associates with gamma H2AX at nuclear foci (REACT_1809), Recruitment of BRCA1 to Unsynapsed Regions (REACT_75884), Phosphorylation of histone H2AX at Serine-139 by ATM at the site of DSB (REACT_108365), Trimethylation of Histone H3 by PRDM9 (REACT_27242), Association of MRN with sites of DSB (REACT_102884), Association of gamma-H2AX with NBS1 (REACT_83587), Phosphorylation of histone H2AX at Serine-139 by ATM at the site of DSB (REACT_1517), Serum amyloid P binds DNA and chromatin (REACT_75858), Phosphorylation of histone H2AX at Serine-139 by ATM at the site of DSB (REACT_89572), phospho-ATM (Serine 1981) associates with DNA at the site of double-strand breaks (REACT_1304), phospho-ATM (Serine 1981) associates with DNA at the site of double-strand breaks (REACT_79247), Association of gamma-H2AX with NBS1 (REACT_109255), Incorporation Of Extended And Processed Telomere End Into Higher Order T-Loop And Associated Protein Structure (REACT_8031), MDC1/NFBD1associates with gamma H2AX at nuclear foci (REACT_107005), Phosphorylation of histone H2AX at Serine-139 by ATM at the site of DSB (REACT_79233), phospho-ATM (Serine 1981) associates with DNA at the site of double-strand breaks (REACT_31640), Association of MRN with sites of DSB (REACT_81249), Incorporation Of Extended And Processed Telomere End Into Associated Protein Structure (REACT_7971), Phosphorylation of histone H2AX at Serine-139 by ATM at the site of DSB (REACT_100988), 53BP1 associates with gamma H2AX at nuclear foci (REACT_1508), ATR Phosphorylates Histone H2A.X at Unsynapsed Regions (REACT_75904), Recruitment of ATR Kinase to Unsynapsed Regions (REACT_75923), Association of MRN with sites of DSB (REACT_1232), BRCA1 associates with 53BP1at the site of DNA double-strand break (REACT_1259), Association of gamma-H2AX with NBS1 (REACT_34104).
biological_process: DNA repair, double-strand break repair via homologous recombination, double-strand break repair, telomere maintenance.
REACTOME_COMPLEX: Extended And Processed Telomere End and Associated DNA Binding and Packaging Protein Complex [nucleoplasm] (REACT_8626), gamma-H2AX:NBS1 complex at the site of double-strand break [nucleoplasm] (REACT_3255), Centromeric Chromatin:CENPH-I:Centromeric Nucleosome:RSF Complex [nucleoplasm] (REACT_23201), Meiotic D-loop Complex [nucleoplasm] (REACT_27539), Meiotic Single-stranded DNA Complex [nucleoplasm] (REACT_27879), gamma H2AX:MDC1/NFBD1 complex at site of DNA double-strand break [nucleoplasm] (REACT_4269), ATM associated with DNA double-strand break ends [nucleoplasm] (REACT_3544), DNA double-strand break ends: MRN complex [nucleoplasm] (REACT_3443), Unsynapsed Chromatin containing gamma-H2A.x [nucleoplasm] (REACT_75943), Nucleosome containing Histone H2A.x [nucleoplasm] (REACT_27840), Nucleosome with Histone H3 Dimethylated at Lysine-4 [nucleoplasm] (REACT_27650), Nucleosome (Deacetylated) [extracellular region] (REACT_76035), Synaptonemal:BRCA1:ATR Complex [nucleoplasm] (REACT_75938), Chromatin [extracellular region] (REACT_76335), Unsynapsed Chromatin [nucleoplasm] (REACT_76872), Nucleosome with H3 dimethylated at lysine-9: HP1gamma Complex [nucleoplasm] (REACT_19440), Centromeric Chromatin: New CENPA Nucleosome:Mis18:HJURP Complex [nucleoplasm] (REACT_23327), Extended And Processed Telomere End and Associated DNA Binding and Packaging Protein Complex Folded Into Higher Order Structure [nucleoplasm] (REACT_8525), Nucleosome containing Histone gamma-H2A.x [nucleoplasm] (REACT_27348), Nucleosome with Deacetylated H4 and H3 Dimethylated at Lysine-9 [nucleoplasm] (REACT_23375), Serum amyloid P-component pentamer:Double-stranded DNA [extracellular region] (REACT_76462), Centromeric Nucleosome [nucleoplasm] (REACT_22498), Synaptonemal:BRCA1 Complex [nucleoplasm] (REACT_76427), gamma H2AX-coated DNA double-strand break ends [nucleoplasm] (REACT_4416), Nucleosome (Deacetylated) [nucleoplasm] (REACT_20128), Telomere Attachment Plate [nuclear envelope, nucleoplasm] (REACT_76658), 53BP1:H2AX complex at site of double-strand break [nucleoplasm] (REACT_3104), MDC1/NFBD1:gamma-H2AX complex [nucleoplasm] (REACT_5218), BRCA1:53BP1 complex at site of DNA double-strand break [nucleoplasm] (REACT_5695), Nucleosome with Histone H3 Trimethylated at Lysine-4 [nucleoplasm] (REACT_27602), Nucleosome [nucleoplasm] (REACT_8671).
REACTOME_PATHWAY: Double-Strand Break Repair (REACT_96237), ATM mediated response to DNA double-strand break (REACT_106958), Double-Strand Break Repair (REACT_30484), Chromosome Maintenance (REACT_22172), Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks (REACT_486), DNA Repair (REACT_107446), Recruitment of repair and signaling proteins to double-strand breaks (REACT_81901), Recruitment of repair and signaling proteins to double-strand breaks (REACT_92672), MRN complex relocalizes to nuclear foci (REACT_85297), Homologous recombination repair of replication-independent double-strand breaks (REACT_1587), Recruitment of repair and signaling proteins to double-strand breaks (REACT_110435), Homologous Recombination Repair (REACT_33853), MRN complex relocalizes to nuclear foci (REACT_1884), Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks (REACT_83319), Packaging Of Telomere Ends (REACT_7963), ATM mediated phosphorylation of repair proteins (REACT_83552), ATM mediated response to DNA double-strand break (REACT_102349), Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks (REACT_106024), MRN complex relocalizes to nuclear foci (REACT_33695), Homologous recombination repair of replication-independent double-strand breaks (REACT_96074), Homologous recombination repair of replication-independent double-strand breaks (REACT_96279), ATM mediated response to DNA double-strand break (REACT_204), DNA Repair (REACT_88201), Meiotic Synapsis (REACT_75792), Homologous recombination repair of replication-independent double-strand breaks (REACT_82234), ATM mediated phosphorylation of repair proteins (REACT_90979), Homologous recombination repair of replication-independent double-strand breaks (REACT_32319), Meiotic Recombination (REACT_27271), Assembly of the RAD50-MRE11-NBS1 complex at DNA double-strand breaks (REACT_108183), Double-Strand Break Repair (REACT_84402), Homologous Recombination Repair (REACT_108237), Homologous Recombination Repair (REACT_1874), ATM mediated phosphorylation of repair proteins (REACT_1924), Double-Strand Break Repair (REACT_2054), Telomere Maintenance (REACT_7970), Recruitment of repair and signaling proteins to double-strand breaks (REACT_97), DNA Repair (REACT_82907), DNA Repair (REACT_93704), ATM mediated response to DNA double-strand break (REACT_110324), Amyloids (REACT_75925), DNA Repair (REACT_216), MRN complex relocalizes to nuclear foci (REACT_89559), Double-Strand Break Repair (REACT_33123), Homologous Recombination Repair (REACT_92897), ATM mediated phosphorylation of repair proteins (REACT_28775), Homologous Recombination Repair (REACT_85965), ATM mediated phosphorylation of repair proteins (REACT_90946), ATM mediated response to DNA double-strand break (REACT_78103).
These properties come from blast2go analysis
molecular_function: DNA binding.
cellular_component: nucleolus, nucleosome.
biological_process: nucleosome assembly.
This polypeptide in other databases
In PhylomeDB is Phy0039YT7_CUCME .

