Polypeptide MELO3C015937P1
Accession: MELO3C015937P1
Name: MELO3C015937P1
Description: Similar to Transcription initiation factor TFIID subunit 13 (Pongo abelii) (uniprot_sprot:sp|Q5R9W6|TAF13_PONAB)
Sequence:
>MELO3C015937P1 Similar to Transcription initiation factor TFIID subunit 13 (Pongo abelii) (uniprot_sprot:sp|Q5R9W6|TAF13_PONAB) MNNSSAGSSSKQRTGSSQPSETSFKRKRGVFQKELQHMMYGFGDDPNPLPESVALMEDIVVEYITELVYKAQEIGSKRGK LSVEDFLYLMRKDPRKLNRSTELLSMNEELKQARRAFEIDEDKLKKAFEEEDKMD*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: translation initiation factor activity, RNA polymerase II transcription factor activity, DNA binding.
cellular_component: plastid.
biological_process: transcription from RNA polymerase II promoter.
These properties come from reactome analysis
REACTOME_REACTION: Recognition and Binding of Core Promoter Elements by TFIID (REACT_100306), HIV-1 Promoter Opening: First Transition (REACT_6134), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), NTP Binds Active Site of RNA Polymerase II (REACT_86985), Fall Back to Closed Pre-initiation Complex (REACT_6211), Recognition and Binding of Core Promoter Elements by TFIID (REACT_745), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Formation of the closed pre-initiation complex (REACT_98407), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Formation of the closed pre-initiation complex (REACT_83351), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Binding of TFIIE to the growing preinitiation complex (REACT_78942), Binding of TFIIE to the growing preinitiation complex (REACT_82447), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_266), RNA Polymerase II Promoter Opening: First Transition (REACT_94679), NTP Binds Active Site of RNA Polymerase II (REACT_84849), Abortive Initiation Before Second Transition (REACT_543), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_83079), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28433), Abortive Initiation Before Second Transition (REACT_106763), Binding of TFIIA and TFIIB to the pol II promoter:TFIID complex (REACT_92302), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_100578), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_103987), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_1684), Formation of the closed pre-initiation complex (REACT_91116), Fall Back to Closed Pre-initiation Complex (REACT_98220), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_93916), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_110236), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Fall Back to Closed Pre-initiation Complex (REACT_100253), Formation of the closed pre-initiation complex (REACT_632), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Recruitment of RNA Polymerase II Holoenzyme by TFIIF to the pol II promoter:TFIID:TFIIA:TFIIB complex (REACT_82574), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Fall Back to Closed Pre-initiation Complex (REACT_92728), Fall Back to Closed Pre-initiation Complex (REACT_1702), Abortive initiation after formation of the first phosphodiester bond (REACT_653), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Fall Back to Closed Pre-initiation Complex (REACT_31744), Recognition and Binding of Core Promoter Elements by TFIID (REACT_82809), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86649), NTP Binds Active Site of RNA Polymerase II (REACT_106132), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Formation of the closed pre-initiation complex (REACT_82855), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), Binding of TFIIE to the growing preinitiation complex (REACT_32367), RNA Polymerase II Promoter Opening: First Transition (REACT_80107), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_88546), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), RNA Polymerase II Promoter Opening: First Transition (REACT_29850).
biological_process: viral reproduction, transcription elongation from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter, gene expression, viral transcription, transcription from RNA polymerase II promoter.
REACTOME_COMPLEX: pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex [nucleoplasm] (REACT_2469), HIV-1 transcription complex [nucleoplasm] (REACT_6433), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), Pol II initiation complex [nucleoplasm] (REACT_5487), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), TFIID [nucleoplasm] (REACT_5886), HIV-1 promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF complex* [nucleoplasm] (REACT_6371), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), pol II promoter:TFIID complex [nucleoplasm] (REACT_5906), pol II promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_2339), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), pol II transcription complex [nucleoplasm] (REACT_2954), HIV-1 promoter:TFIID complex [nucleoplasm] (REACT_6369), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 promoter:TFIID:TFIIA:TFIIB complex [nucleoplasm] (REACT_6531), HIV-1 initiation complex [nucleoplasm] (REACT_6518), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450).
REACTOME_PATHWAY: HIV-1 Transcription Initiation (REACT_6332), RNA Polymerase II Pre-transcription Events (REACT_82104), Transcription of the HIV genome (REACT_6233), RNA Polymerase II Pre-transcription Events (REACT_82727), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), RNA Polymerase II Transcription (REACT_99950), RNA Polymerase II Transcription Initiation (REACT_104646), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_85257), Transcription (REACT_87991), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_83749), RNA Polymerase II Pre-transcription Events (REACT_99660), Formation and Maturation of mRNA Transcript (REACT_96378), Transcription (REACT_100899), Transcription (REACT_1788), Formation and Maturation of mRNA Transcript (REACT_92291), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_87559), RNA Polymerase II Pre-transcription Events (REACT_91707), Gene Expression (REACT_71), RNA Polymerase II Transcription Initiation (REACT_104036), RNA Polymerase II Transcription (REACT_1366), HIV Life Cycle (REACT_6256), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_98915), Gene Expression (REACT_98256), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34355), RNA Polymerase II Transcription (REACT_106213), Formation and Maturation of mRNA Transcript (REACT_2039), Transcription (REACT_34268), RNA Polymerase II Transcription Initiation (REACT_1851), Gene Expression (REACT_108313), RNA Polymerase II Transcription Initiation (REACT_87429), RNA Polymerase II Transcription (REACT_97471), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_34737), Formation and Maturation of mRNA Transcript (REACT_77979), RNA Polymerase II Pre-transcription Events (REACT_22107), HIV Infection (REACT_6185), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), Transcription (REACT_93622), RNA Polymerase II Promoter Escape (REACT_2089), RNA Polymerase II Promoter Escape (REACT_81662), Gene Expression (REACT_105649), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), Formation and Maturation of mRNA Transcript (REACT_32779), RNA Polymerase II Transcription Initiation (REACT_88340), Gene Expression (REACT_91657), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription (REACT_99228).
These properties come from phylome analysis
molecular_function: transferase activity, protein binding, translation initiation factor activity, RNA polymerase II transcription factor activity, DNA binding.
biological_process: transcription from RNA polymerase II promoter.
These properties come from kegg analysis
KEGG_ORTHOLOGS: transcription initiation factor TFIID subunit 13 (K03127).
molecular_function: general RNA polymerase II transcription factor activity.
This polypeptide in other databases
In PhylomeDB is Phy003A8T9_CUCME .