Polypeptide MELO3C015938P2
Accession: MELO3C015938P2
Name: MELO3C015938P2
Description: Similar to DnaJ homolog subfamily B member 11 (Rattus norvegicus) (uniprot_sprot:sp|Q6TUG0|DJB11_RAT)
Sequence:
>MELO3C015938P2 Similar to DnaJ homolog subfamily B member 11 (Rattus norvegicus) (uniprot_sprot:sp|Q6TUG0|DJB11_RAT) MAHRRTKLLFVVCALCYVISAIAGKSYYDILQVQKGASEDQIKRAYRKLALKYHPDKNQGNEEANRRFAEISNAYEVLSD GEKRNIYDRYGEEGLKQHAASGGRGGGMNIQDIFSQFFGGGGGMEEEEKIPKGDDVIVELDASLEDLYMGGSLRVWREKN ILKPAPGKRRCNCRNEVYHKQIGPGMFQQMTEQVCEQCPNVKFEREGYFVTVDIEKGMQDGQEVTFYEDGEPMIDGEAGD LRFRIHTAPHDVFRRDGNDLHATITITLVQALVGFEKSLKHLDEHLVEIGTKGITKPKEVRKFKGEGMPLHFSTKKGDLY VTYEVLFPTSLTEDQKASIQKILG*
Download fasta sequence.
Properties
These properties come from kegg analysis
KEGG_ORTHOLOGS: DnaJ homolog subfamily B member 11 (K09517).
These properties come from phylome analysis
molecular_function: unfolded protein binding, heat shock protein binding.
cellular_component: endoplasmic reticulum lumen, plasma membrane.
biological_process: pathogen-associated molecular pattern dependent induction by symbiont of host innate immunity, protein folding.
These properties come from blast2go analysis
molecular_function: unfolded protein binding, heat shock protein binding.
cellular_component: cytoplasmic membrane-bounded vesicle, plasma membrane.
biological_process: protein folding.
This polypeptide in other databases
In PhylomeDB is Phy003AASA_CUCME .

