Polypeptide MELO3C016014P2

Accession: MELO3C016014P2

Name: MELO3C016014P2

Description: Similar to Thiamin pyrophosphokinase 1 (Mus musculus) (uniprot_sprot:sp|Q9R0M5|TPK1_MOUSE)

Sequence:

>MELO3C016014P2 Similar to Thiamin pyrophosphokinase 1 (Mus musculus) (uniprot_sprot:sp|Q9R0M5|TPK1_MOUSE)
MEVLFHSSDFLLPSPSSSPPNHRRSSTYALVLLNQRLPKFTPLLWKHAQLRLCADGGANRVFDDLPLMFPHLDALDVRNS
YKPDVIRGDMDSIRTEVLEFYAKQGTKIFDESEDQDTTDLHKCVAYILQSIPNQESNLCILVAGALGGRFDHEIGNINVL
CRFSTTRIILLSDDCLIHLLPRTHHHEILIHSSVEGPHCGLIPIGMPSGSTTTTGLQWDLSDTEMKFGGLISTSNIVKEE
KVTVQSDSDLLWTISLKSQN*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: kinase activity, ATP binding, thiamine diphosphokinase activity.

cellular_component: plastid.

biological_process: thiamine diphosphate biosynthetic process, thiamine metabolic process.

These properties come from reactome analysis


REACTOME_REACTION: Thiamin is pyrophosphorylated (REACT_87137), Thiamin is pyrophosphorylated (REACT_89462), Thiamin is pyrophosphorylated (REACT_11233), Thiamin is pyrophosphorylated (REACT_108061), Thiamin is pyrophosphorylated (REACT_32784), Thiamin is pyrophosphorylated (REACT_89139).

biological_process: water-soluble vitamin metabolic process, vitamin metabolic process, thiamine-containing compound metabolic process.

REACTOME_COMPLEX: TPK1 homodimer (Mg2+) [cytosol] (REACT_11433).

REACTOME_PATHWAY: Metabolism of water-soluble vitamins and cofactors (REACT_11238), Vitamin B1 (thiamin) metabolism (REACT_104842), Vitamin B1 (thiamin) metabolism (REACT_11117), Metabolism of vitamins and cofactors (REACT_101968), Metabolism of water-soluble vitamins and cofactors (REACT_99870), Metabolism of water-soluble vitamins and cofactors (REACT_102551), Vitamin B1 (thiamin) metabolism (REACT_29199), Metabolism of vitamins and cofactors (REACT_96278), Metabolism of vitamins and cofactors (REACT_78899), Metabolism of water-soluble vitamins and cofactors (REACT_104143), Metabolism of vitamins and cofactors (REACT_96904), Metabolism of water-soluble vitamins and cofactors (REACT_86005), Metabolism of vitamins and cofactors (REACT_83508), Vitamin B1 (thiamin) metabolism (REACT_79734), Vitamin B1 (thiamin) metabolism (REACT_99932), Vitamin B1 (thiamin) metabolism (REACT_80776), Metabolism of vitamins and cofactors (REACT_11193), Metabolism of water-soluble vitamins and cofactors (REACT_28813).

These properties come from phylome analysis


molecular_function: protein binding, kinase activity, ATP binding, thiamine diphosphokinase activity.

cellular_component: cytosol, cytoplasm.

biological_process: thiamine diphosphate biosynthetic process, thiamine metabolic process.

These properties come from kegg analysis


KEGG_REACTION: ATP:thiamine (R00619), ATP:thiamine-diphosphate (R00616).

KEGG_ORTHOLOGS: thiamine pyrophosphokinase [EC:2.7.6.2] (K00949).

molecular_function: thiamine diphosphokinase activity.

COG: Thiamine pyrophosphokinase (COG1564).

Locations

Located in CM3.5_scaffold00026 from 4098629 to 4102429.

This polypeptide in other databases

In PhylomeDB is Phy003A3T4_CUCME .

Related features