Polypeptide MELO3C016166P1
Accession: MELO3C016166P1
Name: MELO3C016166P1
Description: Similar to Probable glutathione S-transferase parC (Nicotiana tabacum) (uniprot_sprot:sp|P49332|GSTXC_TOBAC)
Sequence:
>MELO3C016166P1 Similar to Probable glutathione S-transferase parC (Nicotiana tabacum) (uniprot_sprot:sp|P49332|GSTXC_TOBAC) MAEEVKLLDFWPSMFGMRVRIALAQKGVAYEYIEEDLRNKSPLLLQMNPIHKKIPVLIHNGKPICESSIIVQYIDEVWND KAPLLPSHPYDRAQARFWVDFIDKKLYDPTRKIWATKGEEHEAGKKEMIEILKQLEQVLGEKDYFGGESMGIIDIALIGF YSWFYTYETIGKFSIEAECPKIISWGKRCLQNESVAKSLPDSRKIYDFVVQVQKAMGII*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: peroxidase activity, lactoylglutathione lyase activity, glutathione transferase activity.
biological_process: auxin mediated signaling pathway.
This polypeptide in other databases
In PhylomeDB is Phy003ME3T_CUCME .

