Polypeptide MELO3C016181P3

Accession: MELO3C016181P3

Name: MELO3C016181P3

Description: Similar to Photosystem II 10 kDa polypeptide, chloroplastic (Solanum tuberosum) (uniprot_sprot:sp|P06183|PSBR_SOLTU)

Sequence:

>MELO3C016181P3 Similar to Photosystem II 10 kDa polypeptide, chloroplastic (Solanum tuberosum) (uniprot_sprot:sp|P06183|PSBR_SOLTU)
MAASVMTSVSLKPAPFTVEKSARGLPSLARNSASFKVVASGGKKIKTDKPYGINGSMNLRDGVDASGRKPKGKGVYQFVD
KYGANVDGYSPIYDTKDWSPTGDVYVGGTTGLAIWAVTLAGLLAGGALLVYNTSALVQ*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: photosystem II 10kDa protein (K03541).

These properties come from phylome analysis


cellular_component: thylakoid membrane, oxygen evolving complex, chloroplast thylakoid membrane.

biological_process: photosystem II oxygen evolving complex assembly, photosynthesis.

These properties come from blast2go analysis


cellular_component: oxygen evolving complex, chloroplast thylakoid membrane.

biological_process: photosynthesis.

Locations

Located in CM3.5_scaffold00027 from 1975957 to 1977705.

This polypeptide in other databases

In PhylomeDB is Phy003A53M_CUCME .

Related features