Polypeptide MELO3C016262P1

Accession: MELO3C016262P1

Name: MELO3C016262P1

Description: Similar to 26S proteasome non-ATPase regulatory subunit RPN12A (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SGW3|RP12A_ARATH)

Sequence:

>MELO3C016262P1 Similar to 26S proteasome non-ATPase regulatory subunit RPN12A (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SGW3|RP12A_ARATH)
MGIGSDPAQNGALKKVKFLLEEQVKSATKVTISNFSKQIQRRKLKKKIAMDPKLTEVSQHFERFKAALVRHDYDSCNNLL
SQLKVFLTGFRSLPPLFEDTPNAVHELTIARDIYEHAVLLSVKVEDQDAFERDFFQLKPYYTDARNRLPPSPQEYPILGL
NLLRLLVQNRIAEFHTELELLSTSALENPCIKHAVELEQSFMEGAYNRVLSARQTVPHETYGYFMDLLAKTVRDEIAGCS
EKAYDYLSINDARQMLLFSSDQELLDYVKEEHPEWEITNGVVYFQKAKESAPCKEIPSLQLINQTLSYARELERIV*

Download fasta sequence.

Properties

These properties come from blast2go analysis


cellular_component: proteasome regulatory particle.

biological_process: proteolysis.

These properties come from reactome analysis


REACTOME_COMPLEX: 26S proteasome [nucleoplasm] (REACT_7467), 26S proteasome [cytosol] (REACT_2353).

These properties come from phylome analysis


molecular_function: protein binding.

cellular_component: proteasome storage granule, proteasome regulatory particle, lid subcomplex, cytoplasm, nucleus, proteasome regulatory particle.

biological_process: positive regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, negative regulation of ubiquitin-protein ligase activity involved in mitotic cell cycle, regulation of apoptosis, negative regulation of vulval development, anaphase-promoting complex-dependent proteasomal ubiquitin-dependent protein catabolic process, RNA interference, mRNA metabolic process, viral reproduction, determination of adult lifespan, DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest, apoptosis, regulation of cellular amino acid metabolic process, ubiquitin-dependent protein catabolic process, M/G1 transition of mitotic cell cycle, S phase of mitotic cell cycle, G1/S transition of mitotic cell cycle, proteolysis.

These properties come from kegg analysis


KEGG_ORTHOLOGS: 26S proteasome regulatory subunit N12 (K03031).

Locations

Located in CM3.5_scaffold00027 from 3042652 to 3045936.

This polypeptide in other databases

In PhylomeDB is Phy003ADJ1_CUCME .

Related features