Polypeptide MELO3C016303P1
Accession: MELO3C016303P1
Name: MELO3C016303P1
Description: Similar to ATP-dependent zinc metalloprotease FtsH 1 (Petrotoga mobilis (strain DSM 10674 / SJ95)) (uniprot_sprot:sp|A9BFL9|FTSH1_PETMO)
Sequence:
>MELO3C016303P1 Similar to ATP-dependent zinc metalloprotease FtsH 1 (Petrotoga mobilis (strain DSM 10674 / SJ95)) (uniprot_sprot:sp|A9BFL9|FTSH1_PETMO) MDEIHALTARRQGIFKESMDNLYIAATQERETTLNQLLIELDGFDTGRGVVFLAATNKRDLLDPLLLRPGRFDRKIKIHP PGAKERLDLLKIHASKVKISNSVDLSIYSQNLLGWLGAMLAQLVQEAALIAVRKGHESIVLSEMDDAVDRLTVGPRRIGI ELGHQGQYRRATTEMGVAITSHLLRR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: microtubule-severing ATPase activity, ATP binding, metalloendopeptidase activity.
biological_process: cell division, proteolysis.
This polypeptide in other databases
In PhylomeDB is Phy003MGUZ_CUCME .

