Polypeptide MELO3C016516P1
Accession: MELO3C016516P1
Name: MELO3C016516P1
Description: Similar to Thioredoxin M4, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SEU6|TRXM4_ARATH)
Sequence:
>MELO3C016516P1 Similar to Thioredoxin M4, chloroplastic (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SEU6|TRXM4_ARATH) PAALEATWQSQVIESKLPVVVEFWASWCGPCRMIHPIIDDLSKEYEGKFKFYKVDTDNNSSIASRYGIRRRQ*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein disulfide oxidoreductase activity, electron carrier activity.
cellular_component: chloroplast envelope, chloroplast thylakoid membrane, cell wall.
biological_process: cell redox homeostasis, glycerol ether metabolic process.
These properties come from phylome analysis
molecular_function: enzyme activator activity, enzyme inhibitor activity, protein disulfide oxidoreductase activity, electron carrier activity.
cellular_component: chloroplast stroma, chloroplast envelope, chloroplast thylakoid membrane, cell wall.
biological_process: negative regulation of catalytic activity, positive regulation of catalytic activity, electron transport chain, response to oxidative stress, transport, regulation of carbohydrate metabolic process, cell redox homeostasis, glycerol ether metabolic process.
Partial gene: true
This polypeptide in other databases
In PhylomeDB is Phy003MH0X_CUCME .
