Polypeptide MELO3C016671P1

Accession: MELO3C016671P1

Name: MELO3C016671P1

Description: Similar to Tryptophanyl-tRNA synthetase, cytoplasmic (Pongo abelii) (uniprot_sprot:sp|Q5R4J1|SYWC_PONAB)

Sequence:

>MELO3C016671P1 Similar to Tryptophanyl-tRNA synthetase, cytoplasmic (Pongo abelii) (uniprot_sprot:sp|Q5R4J1|SYWC_PONAB)
MDKAEADRKVEESVEEDDQVVNPWQVSAKDGGKIDYDKLIDKFGCQRLQPSLVDRVQRLTSRPPHVFLRRGVFFAHRDFD
EILNAYERGEKFYLYTGRGPSSEALHLGHLVPFMFTKYLQDAFKVPLVIQLTDDEKCMWKNLSVEESQRLARENAKDIIA
CGFDISKTFIFSDFDYVGGAFYKNMVKVAKCVTYNKVVGIFGFTGEDHIGKVSFPPVQAVPSFPSSFPHLFSGKDDLRCL
IPCAIDQDPYFRMTRDVAPRLGYHKPALIESSFFPALQGETGKMSASDPNSAIYVTDSAKDIKNKINKYAFSGGQDSIEK
HRLYGANLEVDIPIKYLNFFLDDDAELERITKEYGAGRMLTGEVKQRLIQVLTEMVERHRRARAAVTDEMVDAFMAVRPL
PNMFD*

Download fasta sequence.

Properties

These properties come from blast2go analysis

molecular_function: ATP binding, tryptophan-tRNA ligase activity.

cellular_component: cytosol.

biological_process: tryptophanyl-tRNA aminoacylation.

These properties come from reactome analysis

REACTOME_REACTION: tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_15412), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_85284), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_77584), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_92147), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_34108), tryptophan + tRNA(Trp) + ATP => Trp-tRNA(Trp) + AMP + pyrophosphate (REACT_108647).

biological_process: tRNA aminoacylation for protein translation, gene expression.

REACTOME_COMPLEX: WARS dimer [cytosol] (REACT_15987).

REACTOME_PATHWAY: tRNA Aminoacylation (REACT_89459), Gene Expression (REACT_85241), Gene Expression (REACT_98256), Cytosolic tRNA aminoacylation (REACT_98686), tRNA Aminoacylation (REACT_33855), Cytosolic tRNA aminoacylation (REACT_111025), Cytosolic tRNA aminoacylation (REACT_93590), Gene Expression (REACT_91657), Cytosolic tRNA aminoacylation (REACT_15306), Gene Expression (REACT_105649), Gene Expression (REACT_71), tRNA Aminoacylation (REACT_103575), tRNA Aminoacylation (REACT_99090), Cytosolic tRNA aminoacylation (REACT_31574), tRNA Aminoacylation (REACT_80723), Cytosolic tRNA aminoacylation (REACT_87556), tRNA Aminoacylation (REACT_15482), Gene Expression (REACT_108313).

These properties come from phylome analysis

molecular_function: protein binding, ATP binding, tryptophan-tRNA ligase activity.

cellular_component: cytoplasm, soluble fraction, cytosol.

biological_process: regulation of angiogenesis, locomotion, positive regulation of growth rate, growth, embryo development ending in birth or egg hatching, negative regulation of cell proliferation, nematode larval development, angiogenesis, reproduction, tryptophanyl-tRNA aminoacylation.

These properties come from kegg analysis

KEGG_REACTION: L-Tryptophan (R03664).

molecular_function: tryptophan-tRNA ligase activity.

COG: Tryptophanyl-tRNA synthetase (COG0180).

Locations

Located in CM3.5_scaffold00029 from 1229323 to 1247061.

This polypeptide in other databases

In PhylomeDB is Phy003A231_CUCME .

Related features