Polypeptide MELO3C017184P1
Accession: MELO3C017184P1
Name: MELO3C017184P1
Description: Similar to 60S ribosomal protein L34 (Nicotiana tabacum) (uniprot_sprot:sp|P41098|RL34_TOBAC)
Sequence:
>MELO3C017184P1 Similar to 60S ribosomal protein L34 (Nicotiana tabacum) (uniprot_sprot:sp|P41098|RL34_TOBAC) MVQRLTYRKRHSYATKSNQHRVVKTPGGKLVYQTTKKRASGPKCPVTGKRIQGIPHLRPAEYKRSRLARNRRTVNRAYGG VLSGSAVRERIIRAFLVEEQKIVKKVLKIQKAKEKLASKS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: structural constituent of ribosome.
cellular_component: cytosolic large ribosomal subunit, plasma membrane.
biological_process: ribosome biogenesis, translation.
These properties come from reactome analysis
REACTOME_REACTION: The 60S subunit joins the translation initiation complex (REACT_107675), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_109127), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_79315), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_389), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_98404), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_78279), Signal Recognition (Preprolactin) (REACT_104150), Signal Recognition (Preproinsulin) (REACT_15319), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_91228), Hydrolysis of eEF1A:GTP (REACT_105040), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_31671), Signal Recognition (Preproinsulin) (REACT_82519), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_30444), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_77497), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_15520), eIF5B:GTP is hydrolyzed and released (REACT_29113), Hydrolysis of eEF1A:GTP (REACT_80598), Cleavage of the Signal Peptide of Preproinsulin (REACT_15421), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81196), Translocation of ribosome by 3 bases in the 3 direction (REACT_1937), Formation of UPF1:eRF3 Complex on mRNA with a Premature Termination Codon and No Exon Junction Complex (REACT_75917), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_81882), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_88081), eIF5B:GTP is hydrolyzed and released (REACT_3), SMG1 Phosphorylates UPF1 (Enhanced by Exon Junction Complex) (REACT_75910), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_83432), Interaction between SRP and SRP Receptor (REACT_99006), eIF5B:GTP is hydrolyzed and released (REACT_102209), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_81539), Hydrolysis of eEF1A:GTP (REACT_108111), Release of 40S and 60S subunits from the 80S ribosome (REACT_100903), Signal Recognition (Preprolactin) (REACT_100079), Release of 40S and 60S subunits from the 80S ribosome (REACT_928), Interaction between SRP and SRP Receptor (REACT_15358), Interaction between SRP and SRP Receptor (REACT_83835), Signal Recognition (Preprolactin) (REACT_106280), The 60S subunit joins the translation initiation complex (REACT_81721), The 60S subunit joins the translation initiation complex (REACT_198), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_94459), Interaction between SRP and SRP Receptor (REACT_95183), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_107771), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_1227), UPF1 Binds an mRNP with a Termination Codon Preceding an Exon Junction Complex (REACT_75753), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_227), Translocation of ribosome by 3 bases in the 3 direction (REACT_93691), Release of 40S and 60S subunits from the 80S ribosome (REACT_107539), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_84975), Dissociation of L13a from the 60s ribosomal subunit (REACT_940), Hydrolysis of eEF1A:GTP (REACT_552), Interaction between SRP and SRP Receptor (REACT_28872), Interaction between SRP and SRP Receptor (REACT_103640), Release of 40S and 60S subunits from the 80S ribosome (REACT_86830), Hydrolysis of eEF1A:GTP (REACT_31077), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_29512), Dissociation of L13a from the 60s ribosomal subunit (REACT_90144), Dissociation of L13a from the 60s ribosomal subunit (REACT_32789), eIF5B:GTP is hydrolyzed and released (REACT_81139), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_2075), Release of 40S and 60S subunits from the 80S ribosome (REACT_81831), Hydrolysis of eEF1A:GTP (REACT_31709), Signal Recognition (Preproinsulin) (REACT_110574), Dissociation of L13a from the 60s ribosomal subunit (REACT_91539), The 60S subunit joins the translation initiation complex (REACT_83133), Peptide transfer from P-site tRNA to the A-site tRNA (REACT_28090), Translocation of Preproinsulin to Endoplasmic Reticulum (REACT_95914), Aminoacyl-tRNA binds to the ribosome at the A-site (REACT_103298), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_1654), Signal Recognition (Preprolactin) (REACT_20565), Dissociation of L13a from the 60s ribosomal subunit (REACT_109051), Release of 40S and 60S subunits from the 80S ribosome (REACT_77616), Dissociation of L13a from the 60s ribosomal subunit (REACT_98170), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_29257), GTP bound eRF3:eRF1 complex binds the peptidyl tRNA:mRNA:80S Ribosome complex (REACT_104420), Translocation of ribosome by 3 bases in the 3 direction (REACT_99354), eIF5B:GTP is hydrolyzed and released (REACT_88603), The 60S subunit joins the translation initiation complex (REACT_101966), Translocation of ribosome by 3 bases in the 3 direction (REACT_90731), Signal Recognition (Preproinsulin) (REACT_102110), Signal Recognition (Preproinsulin) (REACT_89495), The 60S subunit joins the translation initiation complex (REACT_32450), GTP Hydrolysis by eRF3 bound to the eRF1:mRNA:polypeptide:80S Ribosome complex (REACT_91109), Polypeptide release from the eRF3-GDP:eRF1:mRNA:80S Ribosome complex (REACT_31222), Signal Recognition (Preprolactin) (REACT_109238), eIF5B:GTP is hydrolyzed and released (REACT_100790).
biological_process: gene expression, mRNA metabolic process, RNA metabolic process, cellular protein metabolic process, translational termination, translational elongation, translation.
REACTOME_COMPLEX: 80S Ribosome:mRNA:peptidyl-tRNA with elongating peptide [cytosol] (REACT_4835), 60S ribosomal complex [cytosol] (REACT_2629), SMG1:UPF1:EJC:Translated mRNP [cytosol] (REACT_76647), Translated mRNA Complex with Premature Termination Codon Preceding Exon Junction [cytosol] (REACT_76510), 80S ribosome [cytosol] (REACT_4330), eRF3-GTP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_4059), 80S Ribosome:mRNA Complex [cytosol] (REACT_21990), 60s ribosomal complex lacking L13a subunit [cytosol] (REACT_4690), Preproinsulin-SRP Complex [cytosol] (REACT_15977), eRF3-GDP:eRF1:80S Ribosome:mRNA:peptidyl-tRNA Complex [cytosol] (REACT_5057), UPF1:eRF3 Complex on Translated mRNA [cytosol] (REACT_76212), Preproinsulin-Translocon Complex [endoplasmic reticulum membrane, cytosol] (REACT_15661), Preproinsulin: Ribosome Nascent Complex [cytosol] (REACT_21205), Preprolactin-SRP Complex [cytosol] (REACT_21159), Translated mRNA Complex with Premature Termination Codon Not Preceding Exon Junction [cytosol] (REACT_76767), Preprolactin Ribosome Nascent Complex [cytosol] (REACT_24551), 80S:Met-tRNAi:mRNA:aminoacyl-tRNA [cytosol] (REACT_3365), SMG1:Phosphorylated UPF1:EJC:Translated mRNP [cytosol] (REACT_76156), eRF3-GDP:eRF1:80S Ribosome:mRNA:tRNA Complex [cytosol] (REACT_4303), Preproinsulin:Ribosome Nascent Complex (translocon associated) [cytosol, endoplasmic reticulum membrane] (REACT_20998), 80S:Met-tRNAi:mRNA [cytosol] (REACT_4537), Phosphorylated UPF1:SMG5:SMG7:SMG6:PP2A:Translated mRNP [cytosol] (REACT_76275), 80S:aminoacyl tRNA:mRNA:eEF1A:GTP [cytosol] (REACT_5558), 80S:Met-tRNAi:mRNA:eIF5B:GTP [cytosol] (REACT_2486), Preproinsulin-SRP-SRP Receptor Complex [endoplasmic reticulum membrane, cytosol] (REACT_15837), Elongation complex with growing peptide chain [cytosol] (REACT_5024).
REACTOME_PATHWAY: Insulin Synthesis and Processing (REACT_93978), Cap-dependent Translation Initiation (REACT_29674), Diabetes pathways (REACT_106585), Insulin Synthesis and Processing (REACT_92168), Peptide chain elongation (REACT_87004), Nonsense Mediated Decay Enhanced by the Exon Junction Complex (REACT_75822), Translation (REACT_77710), Eukaryotic Translation Termination (REACT_103749), Metabolism of proteins (REACT_86658), Formation of a pool of free 40S subunits (REACT_87090), 3 -UTR-mediated translational regulation (REACT_45663), Eukaryotic Translation Initiation (REACT_98138), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_34253), Insulin Synthesis and Processing (REACT_98207), Formation of a pool of free 40S subunits (REACT_107540), Insulin Synthesis and Processing (REACT_78124), Translation (REACT_81833), Cap-dependent Translation Initiation (REACT_100314), 3 -UTR-mediated translational regulation (REACT_105496), Eukaryotic Translation Elongation (REACT_30678), Eukaryotic Translation Termination (REACT_93205), Eukaryotic Translation Initiation (REACT_77252), Eukaryotic Translation Initiation (REACT_30389), Peptide chain elongation (REACT_1404), Metabolism of RNA (REACT_21257), Gene Expression (REACT_105649), Diabetes pathways (REACT_15380), Eukaryotic Translation Elongation (REACT_81624), Cap-dependent Translation Initiation (REACT_110387), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_102684), Eukaryotic Translation Termination (REACT_32804), Nonsense-Mediated Decay (REACT_75886), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_28708), Peptide chain elongation (REACT_106978), Formation of a pool of free 40S subunits (REACT_30395), Gene Expression (REACT_71), Diabetes pathways (REACT_32886), 3 -UTR-mediated translational regulation (REACT_81650), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79), Eukaryotic Translation Termination (REACT_1986), Gene Expression (REACT_98256), Eukaryotic Translation Initiation (REACT_2159), Insulin Synthesis and Processing (REACT_98391), Gene Expression (REACT_108313), Cap-dependent Translation Initiation (REACT_98846), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_97139), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_2085), Gene Expression (REACT_91657), Metabolism of proteins (REACT_99179), Metabolism of proteins (REACT_17015), 3 -UTR-mediated translational regulation (REACT_31427), Translation (REACT_105544), Formation of a pool of free 40S subunits (REACT_103868), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_105871), Eukaryotic Translation Elongation (REACT_93503), Diabetes pathways (REACT_97252), 3 -UTR-mediated translational regulation (REACT_1762), Peptide chain elongation (REACT_32702), Cap-dependent Translation Initiation (REACT_2099), Translation (REACT_86996), Diabetes pathways (REACT_32548), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_79537), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_96420), Insulin Synthesis and Processing (REACT_15550), Metabolism of mRNA (REACT_20605), 3 -UTR-mediated translational regulation (REACT_28457), Translation (REACT_100851), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_110187), Formation of a pool of free 40S subunits (REACT_102010), Metabolism of proteins (REACT_102155), Diabetes pathways (REACT_106636), Nonsense Mediated Decay Independent of the Exon Junction Complex (REACT_75768), L13a-mediated translational silencing of Ceruloplasmin expression (REACT_104915), Peptide chain elongation (REACT_96957), Gene Expression (REACT_85241), Eukaryotic Translation Elongation (REACT_1477), Metabolism of proteins (REACT_91052), Peptide chain elongation (REACT_105694), Metabolism of proteins (REACT_85873), Eukaryotic Translation Elongation (REACT_82124), Eukaryotic Translation Initiation (REACT_33969), GTP hydrolysis and joining of the 60S ribosomal subunit (REACT_91277), Cap-dependent Translation Initiation (REACT_94881), Formation of a pool of free 40S subunits (REACT_1797), Translation (REACT_1014), Eukaryotic Translation Initiation (REACT_91066), Eukaryotic Translation Termination (REACT_94463), Eukaryotic Translation Elongation (REACT_108858).
These properties come from phylome analysis
molecular_function: protein binding, RNA binding, structural constituent of ribosome.
cellular_component: ribosome, cytosolic large ribosomal subunit.
biological_process: positive regulation of growth rate, growth, endocrine pancreas development, viral transcription, embryo development ending in birth or egg hatching, determination of adult lifespan, translational termination, translational elongation, nematode larval development, translation.
These properties come from kegg analysis
cellular_component: cytosolic large ribosomal subunit.
COG: Ribosomal protein L34E (COG2174).
This polypeptide in other databases
In PhylomeDB is Phy003A81O_CUCME .
