Polypeptide MELO3C017285P1
Accession: MELO3C017285P1
Name: MELO3C017285P1
Description: Similar to Whole genome shotgun sequence of line PN40024, scaffold_52.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQ27)
Sequence:
>MELO3C017285P1 Similar to Whole genome shotgun sequence of line PN40024, scaffold_52.assembly12x (Fragment) (Vitis vinifera) (uniref90:UniRef90_D7SQ27) MSIEPFNRLVKLAARAFYDDITTKGDNQPKTGRSDNRGIAVVVLDALTRRQWVREEDLAKNLKLHSKQLRRTLRFLEEEK LITRDHRRETAKGAKIFSAAVAATADGQHQTKEGDEKIKMHTHSYCSLDYAQIYDVVRYRMHRMKKKLKDELEDKNTVQE YICPNCSRRYTALDALRLISFEDEYFHCENCNGELVAESDKLAAVQGGDGDDNARKRRHEKLKDMLQKMEAQLKPLVEQL TRVKDLPVPEFGTLLAWEARASAAARGVNGDLNGNDPSKSSQGYGGTPMPFVGETKVEVAFSGAEGKGVDVKSESKNTGL KVLPPWMIKQGMNLTKEQRGEVKDESKTDAGSASAQFSDDKKSLANDDDKTNIQDEYVKAYYAAILKKQQELEEAAKGQQ ELSSTEVTESVANTNSSRRVGMKAKREEDDDDDDIEWEEAPIGGNANENYKVDLNVEASALVEDEEEDDVDWEEG*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: transcription initiation factor activity, translation initiation factor activity, RNA polymerase II transcription factor activity.
biological_process: transcription initiation from RNA polymerase II promoter.
These properties come from reactome analysis
REACTOME_REACTION: HIV-1 Promoter Opening: First Transition (REACT_6134), Newly formed phosphodiester bond stabilized and PPi released (REACT_6333), Nucleophillic attack by 3-hydroxyl oxygen of nascent HIV-1 transcript on the Alpha phosphate of NTP (REACT_6285), Fall Back to Closed Pre-initiation Complex (REACT_6211), Binding of TFIIE to the growing preinitiation complex (REACT_1821), Addition of nucleotides 5 through 9 on the growing HIV-1 transcript (REACT_6172), Formation of the closed pre-initiation complex (REACT_83351), RNA Polymerase II Promoter Opening: First Transition (REACT_1844), Binding of TFIIE to the growing preinitiation complex (REACT_32367), Abortive HIV-1 Initiation After Second Transition (REACT_6265), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_28192), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_581), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_86674), NTP Binds Active Site of RNA Polymerase II (REACT_80520), Addition of Nucleotides 5 through 9 on the growing Transcript (REACT_100344), NTP binds active site of RNA Polymerase II in HIV-1 open pre-initiation complex (REACT_6349), Fall Back to Closed Pre-initiation Complex (REACT_100253), Formation of the closed pre-initiation complex (REACT_632), Abortive HIV-1 Initiation Before Second Transition (REACT_6203), Abortive Initiation Before Second Transition (REACT_106763), Abortive HIV-1 initiation after formation of the first phosphodiester bond (REACT_6226), Fall Back to Closed Pre-initiation Complex (REACT_1702), Abortive initiation after formation of the first phosphodiester bond (REACT_653), NTP Binds Active Site of RNA Polymerase II (REACT_1160), Nucleophillic Attack by 3-hydroxyl Oxygen of nascent transcript on the Alpha Phosphate of NTP (REACT_1467), Abortive initiation after formation of the first phosphodiester bond (REACT_32630), Abortive Initiation After Second Transition (REACT_1793), Newly Formed Phosphodiester Bond Stabilized and PPi Released (REACT_1055), RNA Polymerase II Promoter Opening: First Transition (REACT_89694), Abortive Initiation Before Second Transition (REACT_543), Abortive Initiation After Second Transition (REACT_103184).
biological_process: transcription from RNA polymerase II promoter, gene expression, viral transcription, viral reproduction, transcription elongation from RNA polymerase II promoter, transcription initiation from RNA polymerase II promoter.
REACTOME_COMPLEX: pol II transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_3928), TFIIE [nucleoplasm] (REACT_2368), Pol II initiation complex [nucleoplasm] (REACT_5487), pol II transcription complex containing 3 Nucleotide long transcript [nucleoplasm] (REACT_3251), pol II open pre-initiation complex [nucleoplasm] (REACT_4930), HIV-1 transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_6640), HIV-1 closed pre-initiation complex [nucleoplasm] (REACT_6553), pol II closed pre-initiation complex [nucleoplasm] (REACT_5734), HIV-1 open pre-initiation complex [nucleoplasm] (REACT_6605), pol II transcription complex [nucleoplasm] (REACT_2954), Pol II Initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_2410), HIV-1 transcription complex containing 4-9 nucleotide long transcript [nucleoplasm] (REACT_6563), pol II transcription complex containing 4 nucleotide long transcript [nucleoplasm] (REACT_4148), HIV-1 Promoter Escape Complex [nucleoplasm] (REACT_6417), Pol II Promoter Escape Complex [nucleoplasm] (REACT_3851), HIV-1 transcription complex [nucleoplasm] (REACT_6433), HIV-1 initiation complex with phosphodiester-PPi intermediate [nucleoplasm] (REACT_6680), HIV-1 initiation complex [nucleoplasm] (REACT_6518), pol II promoter:TFIID:TFIIA:TFIIB:Pol II:TFIIF:TFIIE complex [nucleoplasm] (REACT_4404), HIV-1 transcription complex containing 3 nucleotide long transcript [nucleoplasm] (REACT_6450).
REACTOME_PATHWAY: HIV-1 Transcription Initiation (REACT_6332), RNA Polymerase II Transcription Initiation (REACT_104036), Transcription of the HIV genome (REACT_6233), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_834), Transcription (REACT_100899), Transcription (REACT_1788), RNA Polymerase II Pre-transcription Events (REACT_91707), Gene Expression (REACT_71), RNA Polymerase II Transcription (REACT_1366), HIV Life Cycle (REACT_6256), RNA Polymerase II HIV-1 Promoter Escape (REACT_6253), Formation and Maturation of mRNA Transcript (REACT_2039), RNA Polymerase II Transcription Initiation (REACT_1851), Formation and Maturation of mRNA Transcript (REACT_77979), RNA Polymerase II Pre-transcription Events (REACT_22107), HIV Infection (REACT_6185), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_1655), RNA Polymerase II Promoter Escape (REACT_2089), RNA Polymerase II Promoter Escape (REACT_81662), Gene Expression (REACT_105649), RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (REACT_79444), RNA Polymerase II Transcription Initiation And Promoter Clearance (REACT_109232), Late Phase of HIV Life Cycle (REACT_6361), RNA Polymerase II Transcription (REACT_99228).
These properties come from phylome analysis
molecular_function: zinc ion binding, protein binding, translation initiation factor activity, RNA polymerase II transcription factor activity.
cellular_component: nucleoplasm.
biological_process: interspecies interaction between organisms, viral reproduction, transcription elongation from RNA polymerase II promoter, regulation of transcription, DNA-dependent, transcription initiation from RNA polymerase II promoter.
These properties come from kegg analysis
KEGG_ORTHOLOGS: transcription initiation factor TFIIE subunit alpha (K03136).
molecular_function: general RNA polymerase II transcription factor activity.
COG: Transcription initiation factor IIE, alpha subunit (COG1675).
This polypeptide in other databases
In PhylomeDB is Phy003A48N_CUCME .

