Polypeptide MELO3C017401P1

Accession: MELO3C017401P1

Name: MELO3C017401P1

Description: Similar to ABC transporter I family member 17 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C9W0|AB17I_ARATH)

Sequence:

>MELO3C017401P1 Similar to ABC transporter I family member 17 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9C9W0|AB17I_ARATH)
MIPDTLTPANDSDGIHDGLREHLLVVNEEIENRGVDDHVKIRIRNLTNQILRGISVDIPKGKIVGIIGPSGGGKSTTLRA
LNRLWEPPAGSVFLDGQDIVNLDVLGLRRKVGMLFQIPVLFEGTVADNIRYGPQLRGKKLSDDEVHKLLSLADLDSSFFS
KIGSELSVGQAQRVALARTLANTPEVLLLDEPTSALDPISTENIEDVLVKLKTKWGLTIVMVSHSIKQIQRIADIVCLLV
NGEIVEILPPNKLSEAKHPMALKFLELSS*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: ABCG5:ABCG8-mediated export of cholesterol and phytosterols (REACT_13440).

biological_process: sterol transport, lipid metabolic process.

REACTOME_COMPLEX: ABCG5:ABCG8 heterodimer [plasma membrane] (REACT_14030).

REACTOME_PATHWAY: Metabolism of lipids and lipoproteins (REACT_22258), Lipid digestion, mobilization, and transport (REACT_602), Trafficking of dietary sterols (REACT_13781).

These properties come from phylome analysis


molecular_function: ATPase activity, protein binding, UDP-glucose transmembrane transporter activity, phosphate transmembrane-transporting ATPase activity, ATP binding, inorganic phosphate transmembrane transporter activity.

cellular_component: membrane, vesicle membrane, vacuolar membrane, plasma membrane.

biological_process: response to aluminum ion, transport.

These properties come from blast2go analysis


molecular_function: phosphate transmembrane-transporting ATPase activity, ATP binding, inorganic phosphate transmembrane transporter activity.

cellular_component: plasma membrane.

biological_process: phosphate transport.

Locations

Located in CM3.5_scaffold00030 from 2540073 to 2541528.

This polypeptide in other databases

In PhylomeDB is Phy003LFMD_CUCME .

Related features