Polypeptide MELO3C017661P1

Accession: MELO3C017661P1

Name: MELO3C017661P1

Description: Similar to Protein RFT1 homolog (Dictyostelium discoideum) (uniprot_sprot:sp|Q54IV7|RFT1_DICDI)

Sequence:

>MELO3C017661P1 Similar to Protein RFT1 homolog (Dictyostelium discoideum) (uniprot_sprot:sp|Q54IV7|RFT1_DICDI)
MKDFDKKLSNMCILFTLQSFRKLVLQEGEKMVLVWLDTPYNQAVYGLVDKLGSLVVRLVFLPFEESSYTTFARSASGEYP
DKTRKLAICLSEALKLVVLIGLIFMAFGPSYSYALIRLLYGQKWSDGEAPTALRYYCLYIIVLAMNGTSEAFLHAVANES
QLKKSNDSLLLFSLIYVMLNFLLIRSSGVVGLIFANSINMILRITYSAIFIKGYFKNSSFSFNSCLPSGWIFLLLSGVLT
LISERLFMDQQNFWSTFSLHFSIGLACFLVSLCIIYHRERSFFNKIVRFRQHSD*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: lipid transporter activity.

cellular_component: integral to membrane.

biological_process: lipid transport.

These properties come from reactome analysis


REACTOME_REACTION: Flipping of the N-glycan precursor into the ER lumen (REACT_22198), Flipping of the N-glycan precursor to inside the ER (REACT_22262).

biological_process: cellular protein metabolic process, post-translational protein modification, protein N-linked glycosylation via asparagine, dolichol-linked oligosaccharide biosynthetic process.

REACTOME_PATHWAY: Post-translational protein modification (REACT_22161), Metabolism of proteins (REACT_17015), Biosynthesis of the N-glycan precursor (dolichol lipid-linked oligosaccharide, LLO) and transfer to a nascent protein (REACT_22433), Asparagine N-linked glycosylation (REACT_22426).

These properties come from phylome analysis


molecular_function: protein binding, lipid transporter activity.

cellular_component: endoplasmic reticulum membrane, integral to membrane.

biological_process: post-translational protein modification, positive regulation of locomotion, negative regulation of multicellular organism growth, locomotion, positive regulation of growth rate, glycolipid translocation, protein N-linked glycosylation via asparagine, carbohydrate transport, dolichol-linked oligosaccharide biosynthetic process, protein N-linked glycosylation.

These properties come from kegg analysis


KEGG_ORTHOLOGS: oligosaccharidyl-lipid flippase family (K06316).

Locations

Located in CM3.5_scaffold00031 from 1182506 to 1186047.

This polypeptide in other databases

In PhylomeDB is Phy003MAKA_CUCME .

Related features