Polypeptide MELO3C017676P1

Accession: MELO3C017676P1

Name: MELO3C017676P1

Description: Similar to Mitochondrial import receptor subunit TOM40 homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LHE5|TO401_ARATH)

Sequence:

>MELO3C017676P1 Similar to Mitochondrial import receptor subunit TOM40 homolog 1 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9LHE5|TO401_ARATH)
MAGLAPPTAATATAAPYPLPVPPKKTEDEKVDYLNLPCPIPYEEIHREAFMSLKPELFEGMRFDFTKGLNQKFSLSHSVF
MGPTEIPNQSAETIKIPTATYEFGANFIDPKLMLFGRILTDGRLNARVKCDLSDNLTLKANAQLTNEPHMSHGMVNFDYK
GRDFRTQFQLGNGALFGASYIQSVSPHLSLGGEVFWAGQHRKSGIGYAARYNTDKMVATGQVASTGMVALSYVQKVSEKV
SLATDFTYNYMSRDVISSLGYDYILRQSRLRGKIDSNGCVAAFLEERLNMGVNFILSAEIDHRKKDYKFGFGLTVGE*

Download fasta sequence.

Properties

These properties come from kegg analysis


KEGG_ORTHOLOGS: mitochondrial import receptor subunit TOM40 (K11518).

These properties come from phylome analysis


molecular_function: P-P-bond-hydrolysis-driven protein transmembrane transporter activity, porin activity, protein channel activity, voltage-gated anion channel activity, protein binding, receptor activity.

cellular_component: pore complex, mitochondrial outer membrane translocase complex, mitochondrial outer membrane.

biological_process: positive regulation of multicellular organism growth, positive regulation of growth rate, protein import into mitochondrial matrix, embryo development ending in birth or egg hatching, protein targeting to mitochondrion, reproduction.

These properties come from blast2go analysis


molecular_function: voltage-gated anion channel activity, protein binding, receptor activity.

cellular_component: plasma membrane, mitochondrial outer membrane.

biological_process: transmembrane transport, anion transport.

Locations

Located in CM3.5_scaffold00031 from 1370731 to 1376507.

This polypeptide in other databases

In PhylomeDB is Phy003A7GT_CUCME .

Related features