Polypeptide MELO3C017678P1
Accession: MELO3C017678P1
Name: MELO3C017678P1
Description: Similar to ATP-dependent DNA helicase 2 subunit KU70 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FQ08|KU70_ARATH)
Sequence:
>MELO3C017678P1 Similar to ATP-dependent DNA helicase 2 subunit KU70 (Arabidopsis thaliana) (uniprot_sprot:sp|Q9FQ08|KU70_ARATH) MDLDPDEVFRDDDDDPDNPFFQERESTKELAVYLVDASPKMFSTTCPSEDKKRETHFQVALSCISQSLKTQIINRSYDEV AICFFNTREKKNLQDLNGVFVLNVPEREDLDRPTARLLKTIDGIEEVFMKEIGSQYGIVSGSRENALYNALWAAQALLRK GSAKTLDKRILLFTNEDDPFGSIKGATKFDLIRTTLQRAKDAQDLGISIELFPLSCPNEQFNISLFYADLIGLEGGDLVQ YLPSAGDRLQDMKDQLKKRMFKKRVVRRLKLSITNKLSIDVNSYALIRPTLPGAITWLDSISNRPLKTERSFICADTGAL FLEPSKRFQLYKNQVIKFSGEELSEIKRVSAGHLQLLGFKPLSCLKDYHNLRPSTFLYPSDEGMSGSTCIFIALHRSMVK LNRFAVAFFGSPSHPQLVALVAQDEIITAGGQVEPPGMNMLYLPYADDIRHVEEARKMFSWLEWFS*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: protein binding, ATP-dependent DNA helicase activity, DNA binding.
cellular_component: DNA-dependent protein kinase-DNA ligase 4 complex.
biological_process: double-strand break repair via nonhomologous end joining.
These properties come from reactome analysis
REACTOME_REACTION: Removal of 3-phosphoglycolate (PG) moiety from DSB ends (REACT_6774), Removal of repair proteins and ligation of the processed ends of the DNA double-strand break (REACT_12), Association of Ku heterodimer with ends of DNA double-strand break (REACT_104166), Association of XRCC4:DNA ligase IV complex with viral DNA ends (REACT_9042), 2-LTR formation due to circularization of viral DNA (REACT_9073), Association of Ku heterodimer with ends of DNA double-strand break (REACT_1854), Synapsis, or interaction between two DNA-PK:DNA complexes at opposing ends of DNA DSB (REACT_1971), Association of DNA-PKcs with Ku-bound ends of DNA double-strand breaks (REACT_1989), Association of Ku heterodimer with ends of DNA double-strand break (REACT_84183), Removal of 3-phosphate moiety from DSB ends (REACT_6746), Association of Ku heterodimer with ends of DNA double-strand break (REACT_96293), Association of the XRCC4:DNA ligase IV complex with the DNA-PK:DNA synaptic complex (REACT_657), Association of Ku heterodimer with viral DNA ends (REACT_9022).
biological_process: viral reproduction, DNA repair, double-strand break repair, initiation of viral infection, provirus integration, double-strand break repair via nonhomologous end joining.
REACTOME_COMPLEX: DNA-PK:DNA complex [nucleoplasm] (REACT_2311), DNA-PK:DNA synaptic complex with ligatable ends [nucleoplasm] (REACT_2405), Ku proteins bound to viral DNA [nucleoplasm] (REACT_7016), Ku:DNA double-strand break ends [nucleoplasm] (REACT_5272), DNA-PK:XRCC4:DNA ligase IV:DNA complex associated with ligatable DNA ends [nucleoplasm] (REACT_2526), DNA-PK synaptic complex [nucleoplasm] (REACT_5513), viral DNA:Ku proteins:XRCC4:DNA ligase IV complex [nucleoplasm] (REACT_9308), Ku70:Ku80 heterodimer [nucleoplasm] (REACT_3482).
REACTOME_PATHWAY: Double-Strand Break Repair (REACT_96237), Double-Strand Break Repair (REACT_30484), DNA Repair (REACT_107446), Integration of provirus (REACT_6918), DNA Repair (REACT_88201), Nonhomologous End-joining (NHEJ) (REACT_1022), HIV Life Cycle (REACT_6256), Processing of DNA ends prior to end rejoining (REACT_1201), Nonhomologous End-joining (NHEJ) (REACT_108059), Early Phase of HIV Life Cycle (REACT_6266), Double-Strand Break Repair (REACT_2054), Nonhomologous End-joining (NHEJ) (REACT_110441), DNA Repair (REACT_82907), HIV Infection (REACT_6185), DNA Repair (REACT_216), Nonhomologous End-joining (NHEJ) (REACT_86175), Double-Strand Break Repair (REACT_33123), 2-LTR circle formation (REACT_9058).
These properties come from phylome analysis
molecular_function: 5'-deoxyribose-5-phosphate lyase activity, protein heterodimerization activity, transcription activator activity, promoter binding, protein C-terminus binding, ATP binding, double-stranded DNA binding, protein binding, ATP-dependent DNA helicase activity, DNA binding.
cellular_component: Ku70:Ku80 complex, cytoplasm, chromosome, transcription factor complex, membrane fraction, nuclear telomere cap complex, DNA-dependent protein kinase-DNA ligase 4 complex.
biological_process: positive regulation of transcription from RNA polymerase II promoter, negative regulation of transcription, DNA-dependent, initiation of viral infection, provirus integration, positive regulation of gene-specific transcription from RNA polymerase II promoter, response to heat, transcription, DNA-dependent, DNA recombination, DNA ligation, telomere maintenance, double-strand break repair via nonhomologous end joining.
These properties come from kegg analysis
KEGG_ORTHOLOGS: ATP-dependent DNA helicase 2 subunit 1 (K10884).
This polypeptide in other databases
In PhylomeDB is Phy003MFYC_CUCME .