Polypeptide MELO3C017953P1

Accession: MELO3C017953P1

Name: MELO3C017953P1

Description: Similar to Sodium/calcium exchanger 3 (Rattus norvegicus) (uniprot_sprot:sp|P70549|NAC3_RAT)

Sequence:

>MELO3C017953P1 Similar to Sodium/calcium exchanger 3 (Rattus norvegicus) (uniprot_sprot:sp|P70549|NAC3_RAT)
MASFAIENVESGQAISSITGTGKCESYFIFSFETSLGDALRIFLYFMGLAYCFIGLSAITARFFRSMENVVKHSRKVVEI
DPHTNTEIIRYEKVWNFTIADISLLAFGTSFPQISLATIDAIRNIGNLYAGGLGPGTLVGSAAFDLFPIHAVCVVVPKAG
ELKKISDIGVWLVELVWSFWAYIWLYIILEVWTPKVITLWEALLTVLQYALLLTHAYAQDKRWPYFSLPLARTERPEEWV
PPENAICKQDNPCREEFQAHENEQRSIVDIFSIHDTDGKVYHEVPGHDVAESSNSNIPEEMDGKADHPHVLKIWKQQFVD
ALSLETSESKKQNNIYLRSARLCWQLIRAPWRLLFAFVPPYNIAHGWLAFICSLIFISGIAYILTKFTDLISCVSGINPY
VIAFTALASGTSWPDLVASKIAAERQTTADSAIANITCSNSVNIYVGIGVPWLISTTYNFIAYREPLKIKDAGGLSFSLL
VFFSTSVACIIVLVFRRLTLGAELGGPRVWAWITCIFFMLLWLIFVVLSSLKVSDII*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: K+-dependent Na+/Ca2+ exchanger transport (REACT_19339), Na+/Ca2+ exchanger transport (REACT_82643), Na+/Ca2+ exchanger transport (REACT_78566), Na+/Ca2+ exchanger transport (REACT_19164).

biological_process: platelet activation, ion transport, blood coagulation, transmembrane transport.

REACTOME_PATHWAY: Sodium/Calcium exchangers (REACT_19320), Platelet Activation (REACT_92635), SLC-mediated transmembrane transport (REACT_87124), Platelet Activation (REACT_109042), Platelet calcium homeostasis (REACT_110511), Transmembrane transport of small molecules (REACT_81024), Sodium/Calcium exchangers (REACT_96937), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_29110), Formation of Platelet plug (REACT_96951), Hemostasis (REACT_34525), Reduction of cytosolic Ca++ levels (REACT_93877), Platelet calcium homeostasis (REACT_101113), Platelet homeostasis (REACT_23876), Reduction of cytosolic Ca++ levels (REACT_29523), SLC-mediated transmembrane transport (REACT_19118), Platelet homeostasis (REACT_102058), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_110862), Hemostasis (REACT_604), Platelet Activation (REACT_798), Transmembrane transport of small molecules (REACT_15518), Sodium/Calcium exchangers (REACT_28247), Hemostasis (REACT_82383), Formation of Platelet plug (REACT_90565), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), Transmembrane transport of small molecules (REACT_97365), Platelet homeostasis (REACT_80295), Platelet calcium homeostasis (REACT_23905), Reduction of cytosolic Ca++ levels (REACT_23765), SLC-mediated transmembrane transport (REACT_96636), Formation of Platelet plug (REACT_20).

These properties come from phylome analysis


molecular_function: calcium:sodium antiporter activity.

cellular_component: integral to membrane.

biological_process: magnesium ion transport, phototransduction, cell communication, zinc ion transport, iron ion transport, calcium ion transport, transmembrane transport.

These properties come from blast2go analysis


cellular_component: integral to membrane.

biological_process: transmembrane transport.

Locations

Located in CM3.5_scaffold00031 from 3365495 to 3370357.

This polypeptide in other databases

In PhylomeDB is Phy003MB0V_CUCME .

Related features