Polypeptide MELO3C017998P1
Accession: MELO3C017998P1
Name: MELO3C017998P1
Description: Similar to Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SIE1|PAT_ARATH)
Sequence:
>MELO3C017998P1 Similar to Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase (Arabidopsis thaliana) (uniprot_sprot:sp|Q9SIE1|PAT_ARATH) MANSLHTLPNASRLGFRHQFSGADSASALDSAFGSLSFPSQLLAPSLKSVQLTKKVKPVMAGNIPDHVSVDISLSPRVNS VKPSKTVAISDQATALVQAGVPVIRLAAGEPDFDTPAPITEAGINAIRDGYTRYTANAGTLEVRQAICRKLKDENGLSYT PDQILVSNGAKQSILQAVVAVCSPGDEVIIPAPFWVSYPEMARLADATPVILPTHIDNNFLLDPKLLESKITEKSRLLIL CSPSNPTGSVYPKELLEKIAEIVAKHPRLLVLSDEIYEHIIYAPATHTSFASLPGMWERTLTVNGFSKAFAMTGWRLGYL AGPKHFVSACGKIQSQSTSGASSISQKAAVAALGMGYAGGEAVATMVKAFRERRDYLVKSFGELAGVKISEPQGAFYLFL DFSSYYGAEVEGFGVINNSESLCRYLLEKGQVALVPGDAFGDDSCIRISYAESLSVLQAAVERIKEALEAARPVVPV*
Download fasta sequence.
Properties
These properties come from reactome analysis
REACTOME_REACTION: tyrosine + alpha-ketoglutarate <=> p-hydroxyphenylpyruvate + glutamate (REACT_33184).
REACTOME_PATHWAY: Metabolism of amino acids and derivatives (REACT_29108), Phenylalanine and tyrosine catabolism (REACT_83652).
biological_process: L-phenylalanine catabolic process, cellular nitrogen compound metabolic process.
These properties come from phylome analysis
molecular_function: glutamate-prephenate aminotransferase activity, aspartate-prephenate aminotransferase activity, transferase activity, transferring nitrogenous groups, transaminase activity, pyridoxal phosphate binding, 1-aminocyclopropane-1-carboxylate synthase activity, L-aspartate:2-oxoglutarate aminotransferase activity.
cellular_component: chloroplast.
biological_process: embryo development ending in seed dormancy, aromatic amino acid family biosynthetic process, prephenate pathway, biosynthetic process.
These properties come from blast2go analysis
molecular_function: pyridoxal phosphate binding, 1-aminocyclopropane-1-carboxylate synthase activity, L-aspartate:2-oxoglutarate aminotransferase activity.
cellular_component: chloroplast.
biological_process: biosynthetic process.
This polypeptide in other databases
In PhylomeDB is Phy003A03N_CUCME .

