Polypeptide MELO3C018097P1

Accession: MELO3C018097P1

Name: MELO3C018097P1

Description: Similar to Probable U6 snRNA-associated Sm-like protein LSm4 (Nicotiana tabacum PE=2 SV=1) (uniprot_sprot:sp|Q43582|LSM4_TOBAC)

Sequence:

>MELO3C018097P1 Similar to Probable U6 snRNA-associated Sm-like protein LSm4 (Nicotiana tabacum PE=2 SV=1) (uniprot_sprot:sp|Q43582|LSM4_TOBAC)
MLPLSLLKTAQGHPMLVELKNGETYNGHLVNCDTWMNIHLREVICTSKDGDRFWRMPECYIRGNTIKYLRVPDEVIDKVQ
EETKSRADRKPLGVGRGRGRGREDGPGGRPAKGMGRGFDDGAKAASGGRGKGGPGGKPGANRVGGRGRG*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: mismatched DNA binding, nucleoside-triphosphatase activity, ATP binding, thiamine diphosphokinase activity, RNA-directed DNA polymerase activity, RNA binding.

cellular_component: ribonucleoprotein complex, nucleus.

biological_process: thiamine diphosphate biosynthetic process, RNA splicing, thiamine metabolic process, mRNA processing, mismatch repair, RNA-dependent DNA replication.

These properties come from reactome analysis


REACTOME_REACTION: Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_103648), Binding of Lsm1-7 Complex to Deadenylated mRNA (REACT_87779).

biological_process: exonucleolytic nuclear-transcribed mRNA catabolic process involved in deadenylation-dependent decay, nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay, mRNA metabolic process, RNA metabolic process.

REACTOME_PATHWAY: Deadenylation-dependent mRNA decay (REACT_95337), Metabolism of RNA (REACT_94876), Metabolism of mRNA (REACT_34551), Deadenylation-dependent mRNA decay (REACT_95045), mRNA Decay by 5 to 3 Exoribonuclease (REACT_88584), mRNA Decay by 5 to 3 Exoribonuclease (REACT_110398), Metabolism of RNA (REACT_85788), Metabolism of mRNA (REACT_32511).

These properties come from kegg analysis


KEGG_ORTHOLOGS: U6 snRNA-associated Sm-like protein LSm4 (K12623).

COG: Small nuclear ribonucleoprotein (snRNP) homolog (COG1958).

Locations

Located in CM3.5_scaffold00032 from 941347 to 944133.

This polypeptide in other databases

In PhylomeDB is Phy003LH6T_CUCME .

Related features