Polypeptide MELO3C018322P4
Accession: MELO3C018322P4
Name: MELO3C018322P4
Description: Similar to Putative ATP-dependent DNA helicase RECG (Arabidopsis thaliana) (uniref90:UniRef90_Q9ZVG0)
Sequence:
>MELO3C018322P4 Similar to Putative ATP-dependent DNA helicase RECG (Arabidopsis thaliana) (uniref90:UniRef90_Q9ZVG0) MFDEFFYLQLARLFQMLERLGTRIEKDCLLDKYRQPHLNAAYMKDWACLTQKFLKALPYSLTVSQMKAIAEIIWDLKRPI PMNRLLQVSLFLFFLYVIVFMKATFIQEKKYTRSCFFCHTRAY*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: ATP binding, ATP-dependent DNA helicase activity, nucleic acid binding.
biological_process: DNA recombination, DNA repair.

