Polypeptide MELO3C018474P1

Accession: MELO3C018474P1

Name: MELO3C018474P1

Description: Similar to Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Dictyostelium discoideum) (uniprot_sprot:sp|Q8T9S7|PTEN_DICDI)

Sequence:

>MELO3C018474P1 Similar to Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN (Dictyostelium discoideum) (uniprot_sprot:sp|Q8T9S7|PTEN_DICDI)
MDPNSTDSPISPTVNSSETKPPEVHPQAPVTPGMNNVARDAPSKLSPSGLTSWAKNLKISQPQSSSQDGATENAGKSAFA
RFTSGLGLNLSPKSPAPSDSPDGNSKPAQPSFVGSITKGLVDSSKSAVKAVQVKARHVVSQNKRRYQEGGFDLDMTYITE
NIIAMGFPAGDMSSGFFGYVEGFYRNHMEEVIKFFETHHKGKYKVYNLCSERLYDASLFEGKVACFPFDDHNCPPVQLII
SFCQSAYSWLKDDIENVVVVHCKAGMARTGLMISSLLLFLKFFPTAEESIEYYNQRRCFDGKGLILPSQIRYVKYFERIL
TYFNGENPPSRRCVLRGFRLHRCPYWIRPSITVSDHNGVLFSTKVHPRTKSLSPEDFWFTAPKKGIMVFALPGEPGLAEL
CGDFKVHFHDRQGDFYCWLNTTMTENRKMLYTNDLDGFDKRKLPSPGFQVEVVLVDTSPNTDNTTKKSDESSGSKPPTAD
GSEVSENQNRKSGTNDKDDVFSDSESEGGSSKSKKEATSGTGVEGSAVNTTTKSQTSMTSSDDVASLSHATKQVSLGDGG
AKQTATASERKGDGVGRSDSLPEVPNSESEFKAMAADASVFTFGDDEDYESE*

Download fasta sequence.

Properties

These properties come from blast2go analysis


molecular_function: transferase activity, phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity, protein tyrosine/serine/threonine phosphatase activity, protein tyrosine phosphatase activity.

biological_process: protein dephosphorylation, tRNA modification.

These properties come from reactome analysis


REACTOME_REACTION: PTEN dephosphorylates PIP3 (REACT_104388), Hydrolysis of PIP3 to PIP2 (REACT_98116), Hydrolysis of PIP3 to PIP2 (REACT_12545), PTEN dephosphorylates PIP3 (REACT_12542), Hydrolysis of PIP3 to PIP2 (REACT_92999), PTEN dephosphorylates PIP3 (REACT_86223).

biological_process: phosphatidylinositol-mediated signaling, nerve growth factor receptor signaling pathway, T cell receptor signaling pathway, fibroblast growth factor receptor signaling pathway.

REACTOME_COMPLEX: PTEN (Mg2+ cofactor) [cytosol] (REACT_12877).

REACTOME_PATHWAY: NGF signalling via TRKA from the plasma membrane (REACT_107118), Negative regulation of the PI3K/AKT network (REACT_77658), Signalling by NGF (REACT_90112), Downstream signaling of activated FGFR (REACT_97760), PIP3 activates AKT signaling (REACT_91915), PIP3 activates AKT signaling (REACT_75829), Downstream TCR signaling (REACT_12555), Signalling by NGF (REACT_82686), TCR signaling (REACT_29560), Adaptive Immunity Signaling (REACT_92474), PI-3K cascade (REACT_89467), Signaling by FGFR (REACT_9470), TCR signaling (REACT_102907), Immune System (REACT_84034), NGF signalling via TRKA from the plasma membrane (REACT_102976), Negative regulation of the PI3K/AKT network (REACT_30051), Adaptive Immunity Signaling (REACT_77629), Adaptive Immunity Signaling (REACT_75774), Immune System (REACT_81385), Signaling by FGFR (REACT_94377), TCR signaling (REACT_12526), Negative regulation of the PI3K/AKT network (REACT_12447), PI3K/AKT activation (REACT_12464), Immune System (REACT_6900), Signaling by FGFR (REACT_108645), Downstream TCR signaling (REACT_108620), Downstream signaling of activated FGFR (REACT_21272), PI3K/AKT activation (REACT_88072), PI-3K cascade (REACT_21270), Downstream signaling of activated FGFR (REACT_105316), NGF signalling via TRKA from the plasma membrane (REACT_12056), PI-3K cascade (REACT_84638), PI3K/AKT activation (REACT_97318), Downstream TCR signaling (REACT_88557), PIP3 activates AKT signaling (REACT_91146), Signalling by NGF (REACT_11061).

These properties come from phylome analysis


molecular_function: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity, protein tyrosine/serine/threonine phosphatase activity, protein tyrosine phosphatase activity.

biological_process: protein dephosphorylation.

These properties come from kegg analysis


KEGG_REACTION: Phosphatidylinositol-3,4,5-trisphosphate (R04513).

molecular_function: phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase activity.

Locations

Located in CM3.5_scaffold00034 from 505231 to 510576.

This polypeptide in other databases

In PhylomeDB is Phy003A0HY_CUCME .

Related features