Polypeptide MELO3C018511P1

Accession: MELO3C018511P1

Name: MELO3C018511P1

Description: Similar to Amino acid transporter, putative (Ricinus communis) (uniref90:UniRef90_B9SNC5)

Sequence:

>MELO3C018511P1 Similar to Amino acid transporter, putative (Ricinus communis) (uniref90:UniRef90_B9SNC5)
MGDERRVDAKIAKKLTILPLIALIFYDVSGGPFGVEDSVSTGGGPLLALLGFLVFPFIWSIPEALVTAELATIFPQNGGY
VIWISAAFGPFWGFQEGFWKWFSGAMDNALYPVLFLDYLKRSFPVFNHIFARIPALLGITASLTYLNYRGLHIVGVSAVV
LAVFSLCPFVVMTLLSIPRISPKKWLILEYSKVNWRGYFNSMFWNLNYWDKASTLAGEVENPSKTFPRAMFGAVVLVVSS
YLIPLLAGTGALATDSSEWSDGYFAEVGALIGGVWLKWWIQAAAAMSNMGLFEAEMSSDAYQLLGMSEMGMIPSVFASRS
KYGTPTFSILCSAVGVIFLSWMSFQEILEFLNFLYSVGMLLEFAAFIKLRIRKPDLNRPYKVPLQTVGVTLLCFPPSALL
ILVMCLASAKTFLISGIIIAVGFLLYPTLLQAKNRRWVKFISEQPEDTTLSDVEDRLVEPQPQQEVPNEAEVRLLSESSS
SNIAQQ*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: SLC7A11-mediated exchange of extracellular cysteine and cytosolic glutamate (REACT_15324), SLC7A7 (y+LAT1)-mediated exchange of extracellular leucine for cytosolic arginine (REACT_33631), SLC7A7 (y+LAT1)-mediated exchange of extracellular leucine for cytosolic arginine (REACT_15441), SLC7A6 (y+LAT2)-mediated exchange of extracellular leucine for cytosolic arginine (REACT_15318), Basigin binds CD98 complex (REACT_87742), Basigin binds CD98 complex (REACT_16988), SLC7A8-mediated uptake of neutral amino acids (REACT_91929), SLC7A10-mediated uptake of small neutral amino acids (REACT_80898), SLC7A8-mediated uptake of neutral amino acids (REACT_13482).

biological_process: leukocyte migration, cellular nitrogen compound metabolic process, ion transport, blood coagulation, transmembrane transport, amino acid transport.

REACTOME_COMPLEX: SLC7A6:SLC3A2 heterodimer [plasma membrane] (REACT_17753), SLC7A7:SLC3A2 heterodimer [plasma membrane] (REACT_17357), SLC7A11:SLC3A2 heterodimer [plasma membrane] (REACT_16127), Basigin:CD98hc complex [plasma membrane] (REACT_17413), SLC7A8:SLC3A2 heterodimer [plasma membrane] (REACT_14666).

REACTOME_PATHWAY: Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_91958), Transmembrane transport of small molecules (REACT_15518), Hemostasis (REACT_604), Amino acid and oligopeptide SLC transporters (REACT_30787), Amino acid transport across the plasma membrane (REACT_13796), Basigin interactions (REACT_79881), Metabolism of amino acids and derivatives (REACT_13), SLC-mediated transmembrane transport (REACT_19118), Cell surface interactions at the vascular wall (REACT_98799), Basigin interactions (REACT_12560), Transmembrane transport of small molecules (REACT_86409), Metabolism of amino acids and derivatives (REACT_86268), SLC-mediated transmembrane transport (REACT_98716), Cell surface interactions at the vascular wall (REACT_12051), Amino acid transport across the plasma membrane (REACT_90553), Transport of inorganic cations/anions and amino acids/oligopeptides (REACT_19397), Hemostasis (REACT_92318), Amino acid and oligopeptide SLC transporters (REACT_19419).

These properties come from phylome analysis


molecular_function: amino acid transmembrane transporter activity.

cellular_component: integral to membrane.

These properties come from blast2go analysis


molecular_function: cationic amino acid transmembrane transporter activity, amino acid transmembrane transporter activity.

cellular_component: integral to membrane.

biological_process: transmembrane transport, amino acid transport.

Locations

Located in CM3.5_scaffold00034 from 748873 to 751132.

This polypeptide in other databases

In PhylomeDB is Phy003AF4O_CUCME .

Related features