Polypeptide MELO3C018512P1
Accession: MELO3C018512P1
Name: MELO3C018512P1
Description: Similar to 40S ribosomal protein S29 (Triticum aestivum) (uniprot_sprot:sp|Q5I7K3|RS29_WHEAT)
Sequence:
>MELO3C018512P1 Similar to 40S ribosomal protein S29 (Triticum aestivum) (uniprot_sprot:sp|Q5I7K3|RS29_WHEAT) MGHSNVWNSHPKNYGPGSRTCRVCGNPHGLIRKYGLMCCRQCFRSNAKEIGFIKYR*
Download fasta sequence.
Properties
These properties come from kegg analysis
cellular_component: cytosolic small ribosomal subunit.
COG: Ribosomal protein S14 (COG0199).
These properties come from phylome analysis
molecular_function: metal ion binding, protein binding, RNA binding, zinc ion binding, structural constituent of ribosome.
cellular_component: small ribosomal subunit, ribosome, cytosolic small ribosomal subunit.
biological_process: neuron development, positive regulation of growth rate, growth, endocrine pancreas development, viral transcription, body morphogenesis, embryo development ending in birth or egg hatching, translational termination, translational elongation, nematode larval development, reproduction, translation.
These properties come from blast2go analysis
molecular_function: zinc ion binding, structural constituent of ribosome.
cellular_component: cytosolic small ribosomal subunit.
biological_process: translation.
This polypeptide in other databases
In PhylomeDB is Phy003A1YZ_CUCME .

