Polypeptide MELO3C018841P1

Accession: MELO3C018841P1

Name: MELO3C018841P1

Description: Similar to Beta-adaptin-like protein C (Arabidopsis thaliana) (uniprot_sprot:sp|O81742|APBLC_ARATH)

Sequence:

>MELO3C018841P1 Similar to Beta-adaptin-like protein C (Arabidopsis thaliana) (uniprot_sprot:sp|O81742|APBLC_ARATH)
MSGHDSKYFSTTKKGEIPELKEELNSQYKDKRKDAVKKVIAAMTVGKDVSSLFTDVVNCMQTENLELKKLVYLYLINYAK
SQPDLAILAVNTFVKDSQDPNPLIRALAVRTMGCIRVDKITEYLCDPLQRCLKDDDPYVRKTAAICVAKLFDINAELVED
RGFLDSLKDLISDNNPMVVANAVAALAEIQEDSSKPIFEITSHTLSKLLTALNECTEWGQVFILDALSKYKTEDAREAEN
IVERVTPRLQHANCAVVLSAVKMILLQMELITSTDIVRNLCKKMAPPLVTLLSSEPEIQYVALRNINLIVQKRPTILAHE
IKVFFCKYNDPIYVKMEKLEIMIKLASDRNIDQVLLEFKEYATEVDVDFVRKAVRAIGRCAIKLERAAERCISVLLELIK
IKVNYVVQEAIIVIKDIFRRYPNTYESIIATLCESLDTLDEPEAKASMIWIIGEYAERIDNADELLESFLESFPEEPAQV
QLQLLTATVKLFLKKPTEGPQQMIQAVLNNATVETDNPDLRDRAYIYWRLLSTDPEAAKDVVLAEKPVIGDDSNLLDSTL
LDELLANIATLSSVYHKPPEAFVTRVKNVSQRTDDDDYPEGSDAGYSEPPVNATSGGSASPTTSDAPYSVTKRPVPAPAP
SSPPPPASVPDLLGDLIGLDNSAIAPVDQSAAPAGPPLPILLTASAGQGLQISAQLIRHDGQIFYSLTFDNSTQMILDGF
MIQFNKNTFGLAAAGPLQVPQLQPGSIANTLLHMVVFQNMSQGPPSSLLQVAVKNNQQPVLYFNDKIPMHIFFTEDGRME
RASFLETWRSLPDSNEVIRDFPTILINNVEAILERLAATNMFFIAKRKHANQDVFYFSTKIPRGIPFLIELTTVVGNPGL
KCAVKTPNIDMAPLFFEALEILIKE*

Download fasta sequence.

Properties

These properties come from reactome analysis


REACTOME_REACTION: Axonal transport of NGF:Trk complexes (REACT_77014), Transport of L1 from C-domain to P-domain (REACT_22136), trans-Golgi Network Derived Vesicle Uncoating (REACT_19124), Transport of MHC I:Nef:AP-1:PACS-1 Complex (REACT_11229), L1 binds to AP-2 Clathrin complex (REACT_22118), Endocytosis (internalization) of clathrin-coated vesicle (REACT_30562), Phosphorylation of L1 by p90rsk (REACT_93505), trans-Golgi Network Vesicle Scission (REACT_63828), Formation of clathrin-coated vesicle (REACT_12559), Formation of CD4:Nef:AP-2 Complex:v-ATPase Complex (REACT_11091), trans-Golgi Network Coat Assembly (REACT_19334), Phosphorylation of L1 by ERK (REACT_22099), L1 binds to AP-2 Clathrin complex (REACT_80391), Phosphorylation of L1 by ERK (REACT_29300), Axonal transport of NGF:Trk complexes (REACT_12385), Phosphorylation of L1 by ERK (REACT_29029), trans-Golgi Network Coat Assembly (REACT_108535), Trafficking of GluR2-containing AMPA receptors to extrasynaptic sites (REACT_18330), trans-Golgi Network Derived Lysosomal Vesicle Uncoating (REACT_19206), Transport of L1 into endosomes (REACT_94455), Transport of L1 into endosomes (REACT_103820), trans-Golgi Network Lysosome Vesicle Destined Membrane Coat Assembly (REACT_19167), Phosphorylation of L1 by p90rsk (REACT_22240), Reinsertion of L1 into the plasma membrane (REACT_22298), Formation of CD8:Nef:AP-2 Complex:v-ATPase Complex (REACT_11125), Transport of L1 into endosomes (REACT_22103), Formation of clathrin coated vesicle (REACT_22359), Formation of clathrin coated vesicle (REACT_98431), Formation of clathrin coated vesicle (REACT_87661), Formation of MHC I:Nef:AP-1:PACS-1 Complex (REACT_11186), L1 binds to AP-2 Clathrin complex (REACT_94148), Trafficking of GluR2-containing AMPA receptors to extrasynaptic sites (REACT_97035), Endocytosis (internalization) of clathrin-coated vesicle (REACT_92176), trans-Golgi Network Lysosome Vesicle Destined Membrane Coat Assembly (REACT_103038), trans-Golgi Network Vesicle Scission (REACT_91588), Vamp And trans-Golgi Network AP-1 Binding Coupled With Cargo Capture (REACT_19391), Assembly in clathrin-coated vesicles (CCVs) (REACT_12495), Endocytosis (internalization) of clathrin-coated vesicle (REACT_12397), trans-Golgi Network Coat Assembly (REACT_83374), trans-Golgi Network Vesicle Scission (REACT_19255), Internalization of the CD8:Nef:AP-2 Complex:v-ATPase Complex (REACT_11069), trans-Golgi Network Lysosomal Vesicle Scission (REACT_19194), Internalization of the CD4:Nef:AP-2 Complex:v-ATPase Complex (REACT_11160), Phosphorylation of L1 by p90rsk (REACT_89089), Vamp And trans-Golgi Network AP-1 Binding Coupled With Cargo Capture On Lysosome Vesicle Destined Golgi Membrane (REACT_19371), trans-Golgi Network Lysosomal Vesicle Scission (REACT_86358).

biological_process: viral reproduction, post-Golgi vesicle-mediated transport, nerve growth factor receptor signaling pathway, synaptic transmission, epidermal growth factor receptor signaling pathway, regulation of defense response to virus by virus, cellular membrane organization, axon guidance, negative regulation of epidermal growth factor receptor signaling pathway.

REACTOME_COMPLEX: pL1 (S1152):p90rsk:clathrin-dynamin complex [endosome] (REACT_23209), Adaptor protein 2 complex [plasma membrane] (REACT_13288), AP-1 Complex [cytosol] (REACT_11249), Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [cytoplasmic vesicle membrane] (REACT_15080), L1:AP-2 Clathrin complex [endosome] (REACT_22916), Internalized CD4:Nef:Clathrin-Coated Pit Adapter Protein:v-ATPase [cytosol, early endosome membrane] (REACT_11967), Clathrin-coated vesicle [plasma membrane] (REACT_13103), EGF:Phospho-EGFR (Y1045) dimer:Phospho-CBL:GRB2:CIN85:Endophilin:Epsin:Eps15R:Eps15 complex:Clathrin [plasma membrane] (REACT_13237), AP-1 Complex [Golgi membrane] (REACT_14976), AP-1 Complex [lysosomal membrane] (REACT_20476), CD4:Nef:AP-2 Complex:v-ATPase Complex [cytosol, plasma membrane] (REACT_11339), Cargo:AP-1:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19464), AP-1 Complex [cytoplasmic vesicle membrane] (REACT_14951), pL1 (S1204, 1248):ERK2:clathrin-dynamin complex [endosome] (REACT_23286), Lysosome Destined Cargo:AP-1:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19991), AP2 complex [endocytic vesicle membrane] (REACT_18535), L1:clathrin-coated vesicle [plasma membrane] (REACT_22698), CD8:Nef:AP-2 Complex:v-ATPase Complex [cytosol, plasma membrane] (REACT_11369), Lysosome Cargo:AP-1:Beta-arrestin:Clathrin Triskelion:Vamp Complex [lysosomal membrane] (REACT_19609), Lysosome Destined Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_20224), L1:AP-2 Clathrin complex [clathrin-coated endocytic vesicle] (REACT_22867), Activated TrkA receptor complex:Clathrin-coated vesicle:dynein:dynactin complex [clathrin-coated endocytic vesicle membrane] (REACT_13375), Internalized CD8:Nef:Clathrin-Coated Pit Adapter Protein:v-ATPase [cytosol, early endosome membrane] (REACT_11305), Activated TrkA receptor complex:Clathrin-coated vesicle [plasma membrane] (REACT_13141), Activated TrkA receptor complex:Clathrin-coated vesicle [clathrin-coated endocytic vesicle membrane] (REACT_13349), Nef:class I MHC complex:AP-1:PACS-1 Complex [early endosome membrane, cytosol] (REACT_11657), Cargo:AP-1:Arf1-GTP:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_20036), AP-2 Complex [cytosol] (REACT_11732), Cargo:AP-1:Beta-arrestin:Vamp:Clathrin Triskelion:Dynamin:Endophilin Complex [Golgi membrane] (REACT_14893), Nef:class I MHC complex:Ap-1:PACS-1 Complex [Golgi membrane, cytosol] (REACT_11308), AP2 clathrin:L1:KIF4:microtubule [cytosol] (REACT_23331), Lysosome Destined Cargo:AP-1:Arf1-GTP:beta-Arrestin-1:Vamp Complex [Golgi membrane] (REACT_19668).

REACTOME_PATHWAY: Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_15370), trans-Golgi Network Vesicle Budding (REACT_98073), Axon guidance (REACT_29862), Recycling pathway of L1 (REACT_22365), Retrograde neurotrophin signalling (REACT_12435), Synaptic Transmission (REACT_89785), Lysosome Vesicle Biogenesis (REACT_19287), NGF signalling via TRKA from the plasma membrane (REACT_29880), Nef Mediated CD8 Down-regulation (REACT_11200), Signalling by NGF (REACT_82110), Axon guidance (REACT_110262), Signal transduction by L1 (REACT_94201), Signal transduction by L1 (REACT_89899), Golgi Associated Vesicle Biogenesis (REACT_83422), Clathrin derived vesicle budding (REACT_93134), Transmission across Chemical Synapses (REACT_13477), Transmission across Chemical Synapses (REACT_29683), Golgi Associated Vesicle Biogenesis (REACT_19400), L1CAM interactions (REACT_89546), EGFR downregulation (REACT_12484), Signaling by EGFR (REACT_9417), Clathrin derived vesicle budding (REACT_19187), The role of Nef in HIV-1 replication and disease pathogenesis (REACT_6835), NGF signalling via TRKA from the plasma membrane (REACT_100895), Lysosome Vesicle Biogenesis (REACT_78428), L1CAM interactions (REACT_22205), Retrograde neurotrophin signalling (REACT_78607), Synaptic Transmission (REACT_13685), trans-Golgi Network Vesicle Budding (REACT_30453), Retrograde neurotrophin signalling (REACT_109185), Clathrin derived vesicle budding (REACT_99578), Membrane Trafficking (REACT_11123), Signal transduction by L1 (REACT_22272), Nef mediated downregulation of MHC class I complex cell surface expression (REACT_11103), trans-Golgi Network Vesicle Budding (REACT_11235), Recycling pathway of L1 (REACT_90399), L1CAM interactions (REACT_94606), Signalling by NGF (REACT_97378), Membrane Trafficking (REACT_34084), HIV Infection (REACT_6185), Trafficking of GluR2-containing AMPA receptors (REACT_94302), Recycling pathway of L1 (REACT_84142), Trafficking of AMPA receptors (REACT_80272), NGF signalling via TRKA from the plasma membrane (REACT_12056), Host Interactions of HIV factors (REACT_6288), Membrane Trafficking (REACT_87431), Trafficking of AMPA receptors (REACT_18307), Glutamate Binding, Activation of AMPA Receptors and Synaptic Plasticity (REACT_18347), Nef Mediated CD4 Down-regulation (REACT_11166), Nef-mediates down modulation of cell surface receptors by recruiting them to clathrin adapters (REACT_11149), Trafficking of GluR2-containing AMPA receptors (REACT_18422), Glutamate Binding, Activation of AMPA Receptors and Synaptic Plasticity (REACT_30871), Signalling by NGF (REACT_11061), Golgi Associated Vesicle Biogenesis (REACT_99248), Neuroransmitter Receptor Binding And Downstream Transmission In The Postsynaptic Cell (REACT_91125), Axon guidance (REACT_18266).

These properties come from blast2go analysis


molecular_function: protein transporter activity, protein binding.

cellular_component: clathrin adaptor complex.

biological_process: vesicle-mediated transport, intracellular protein transport.

Locations

Located in CM3.5_scaffold00034 from 3243909 to 3249761.

This polypeptide in other databases

In PhylomeDB is Phy003LKIJ_CUCME .

Related features