Polypeptide MELO3C018910P2
Accession: MELO3C018910P2
Name: MELO3C018910P2
Description: Similar to Putative uncharacterized protein (Vitis vinifera) (uniref90:UniRef90_A5AW24)
Sequence:
>MELO3C018910P2 Similar to Putative uncharacterized protein (Vitis vinifera) (uniref90:UniRef90_A5AW24) MAQKEERLPNRDELAESLNEFFTSVSEMIKSDLLGSSNQLELLERMNSRVAEEYKGYGDVASGMRVFVEQLKSKSGGFDE YIHQIEKIEHQVTEFEAVISMLDKHVSMLESKVLSVCQNTP*
Download fasta sequence.
Properties
These properties come from phylome analysis
molecular_function: gamma-tubulin binding, identical protein binding, protein C-terminus binding.
cellular_component: BLOC-1 complex, centrosome, nucleus, gamma-tubulin complex.
biological_process: platelet dense granule organization, positive regulation of transcription from RNA polymerase II promoter, positive regulation of transcription, DNA-dependent, regulation of apoptosis, melanosome organization, positive regulation of cell proliferation, microtubule nucleation.
This polypeptide in other databases
In PhylomeDB is Phy003ADWS_CUCME .

