Polypeptide MELO3C019172P1
Accession: MELO3C019172P1
Name: MELO3C019172P1
Description: Similar to Zeatin O-xylosyltransferase (Phaseolus vulgaris) (uniprot_sprot:sp|P56725|ZOX_PHAVU)
Sequence:
>MELO3C019172P1 Similar to Zeatin O-xylosyltransferase (Phaseolus vulgaris) (uniprot_sprot:sp|P56725|ZOX_PHAVU) MAWLDQQEPRSVIYISFGTTTTMKDEQIKEIAIGLARSDQKFIWVLRDADKGDVFDVNEIRKSNLPEGYNNLIGDQGLVI KDWAPQLEILGHWATGGFMTHCGWNSCIESITTGVPVIAWPMHSDQPRNTVLMTRVLCVGVGLKEWQQELIMAGAIEEVV RKLMVSEEGAKVRRNAERLGNVVRQSLEEGGESRKEFEAFVAHITR*
Download fasta sequence.
Properties
These properties come from blast2go analysis
molecular_function: transferase activity, transferring hexosyl groups, UDP-glycosyltransferase activity.
cellular_component: nuclear pore.
biological_process: metabolic process, transport.
This polypeptide in other databases
In PhylomeDB is Phy003MESB_CUCME .

